KEGG   Butyrate-producing bacterium SS3/4: CK3_31760Help
Entry
CK3_31760         CDS       T02611                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bprs  Butyrate-producing bacterium SS3/4
Pathway
bprs00473  D-Alanine metabolism
bprs01100  Metabolic pathways
bprs01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bprs00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CK3_31760
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CK3_31760
Enzymes [BR:bprs01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CK3_31760
Peptidoglycan biosynthesis and degradation proteins [BR:bprs01011]
 Precursor biosynthesis
  Racemase
   CK3_31760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CBL42614
UniProt: D7GP79
LinkDB All DBs
Position
complement(3194501..3195676)
Genome map
AA seq 391 aa AA seqDB search
MEFDRIYAEVDLGRIEENMEAMKEHLRPGTKMYGVVKTDAYGHGAVPVARTIDRFVCGYA
VATVDEGLKLRRHGIEKEILSLGPVSAGRYQECLENDISLPFFEYRRAKELSDAAAAEGK
TAKIHIAVDTGMSRIGLFPDEGSVETVKEIAELPALRIAGMFTHFARADEADKTNAGEQY
SRFHAFCDAVKAAGVDVPVCHCSNSAGIVELPDFNMDAVRAGITIYGLYPSDEVKQDIIS
LKPAMALKSFITYIKEIGPGTEVSYGGTFKAEKTMRIATVSAGYGDGYPRNLSGKGEVLI
HGKRAKILGRICMDQFMVDLTGIPEAKEGDSVTLVGRDGNQEITMEELAEISGGFHYEIP
CLIGKRVPRRYVKNGKEVGGMMCRDEEYEGF
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggaatttgacagaatctacgcagaggtggatctcgggcgtattgaagaaaatatggag
gccatgaaggagcatcttcgtccgggaacgaagatgtacggcgtggtaaagacggatgca
tacggacacggggcagttccggtggcgaggaccatcgaccgttttgtctgtgggtacgcg
gtggcaacggtggatgaggggcttaagctcaggagacatggaatcgaaaaagagatcctg
agtcttggtccggtttcagccggccgctatcaggaatgtcttgaaaatgacatcagtctg
ccgttttttgagtaccggagagcaaaagaattatcagatgccgctgcggcagagggaaag
accgcgaagatccacatcgcggtggatacgggaatgagccgtatcggacttttcccggat
gagggatccgtggagaccgtaaaggagatcgcagagcttccggctctcaggatcgccggt
atgttcacccacttcgcccgggcggacgaggcggataagacgaatgcaggggagcagtac
agtcggttccatgcgttctgtgatgctgtgaaggcagccggcgtggacgtcccggtctgt
cactgttccaacagcgccggaatcgtggaactccccgattttaacatggacgcggtccgc
gcgggaatcacgatctacggcctgtacccgtcggatgaagtaaaacaggatatcatttct
ctgaaaccggcgatggcgttaaagagctttatcacttacatcaaggagatcggaccggga
acggaggtcagctacggcggaacctttaaggcggagaagacgatgcggatcgctacggtc
tctgcaggttacggggatggctatccgagaaatctctccggaaaaggagaagtgctgatc
catggaaaacgggcaaagatcttaggacggatctgtatggaccagtttatggtggacctt
acggggatcccggaggccaaagagggagattctgtgactcttgtgggcagagacgggaat
caggagatcactatggaggagcttgcagagatttccggcggattccattacgagatccca
tgcctgataggaaaacgtgtgccgcggcggtacgtgaagaatggaaaagaagtgggcggc
atgatgtgcagggatgaggagtacgaaggcttctga

DBGET integrated database retrieval system