KEGG   Burkholderia pseudomallei K96243: BPSL0443Help
Entry
BPSL0443          CDS       T00203                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00010  Glycolysis / Gluconeogenesis
bps00260  Glycine, serine and threonine metabolism
bps00680  Methane metabolism
bps01100  Metabolic pathways
bps01110  Biosynthesis of secondary metabolites
bps01120  Microbial metabolism in diverse environments
bps01130  Biosynthesis of antibiotics
bps01200  Carbon metabolism
bps01230  Biosynthesis of amino acids
Module
bps_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bps_M00002  Glycolysis, core module involving three-carbon compounds
bps_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPSL0443 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    BPSL0443 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPSL0443 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bps04131]
    BPSL0443 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bps04147]
    BPSL0443 (gpmA)
Enzymes [BR:bps01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BPSL0443 (gpmA)
Membrane trafficking [BR:bps04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BPSL0443 (gpmA)
Exosome [BR:bps04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BPSL0443 (gpmA)
  Exosomal proteins of melanoma cells
   BPSL0443 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 3093540
NCBI-ProteinID: YP_107068
UniProt: Q63XU7
LinkDB All DBs
Structure
PDB: 

Position
1:complement(483930..484679)
Genome map
AA seq 249 aa AA seqDB search
MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNREARQAGQLLKEAGYTFDIAYTSVLKR
AIRTLWHVQDQMDLMYVPVVHSWRLNERHYGALSGLNKAETAAKYGDEQVLVWRRSYDTP
PPALEPGDERAPYADPRYAKVPREQLPLTECLKDTVARVLPLWNESIAPAVKAGKQVLIA
AHGNSLRALIKYLDGISDADIVGLNIPNGVPLVYELDESLTPIRHYYLGDQEAIAKAQAA
VAQQGKSAA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagctcgttctcatccgccacggcgaatcgacgtggaacaaggaaaaccgcttc
accggctgggtcgatgtcgacctgaccgaacaaggcaaccgcgaagcccggcaggcgggc
cagctcctgaaggaagccggctacacgttcgatatcgcatacacgtcggtgctcaagcgc
gcgatccgcacgctctggcacgtgcaggaccagatggatctgatgtacgtgcccgtcgtg
cattcgtggcgcctgaacgagcgccattacggcgcgctgtcgggcctgaacaaggcggag
acggccgcgaagtacggcgacgagcaggtgctcgtctggcgccgcagctacgacacgccg
ccgcccgcgctcgagccgggcgacgagcgcgcgccgtacgccgatccgcgctacgcgaag
gtgccgcgtgagcagttgccgctcaccgagtgcctgaaggacacggtcgcgcgcgtgctg
ccgctctggaacgaatcgatcgcgcccgcggtgaaggccggcaagcaggtgctgatcgcc
gcgcacggcaactcgctgcgcgcgctgatcaagtatctcgacggcatctccgacgcggac
atcgtcggcctgaacatcccgaacggcgtgccgctcgtctacgagctcgacgagagcctc
acgcccatccggcactactacctcggcgatcaggaggcgatcgcgaaggcgcaggccgcc
gtcgcgcagcagggcaagtccgcggcgtaa

DBGET integrated database retrieval system