KEGG   Burkholderia pseudomallei K96243: BPSL0597Help
Entry
BPSL0597          CDS       T00203                                 

Definition
(RefSeq) protein kinase
Organism
bps  Burkholderia pseudomallei K96243
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AAA_16 AAA_22 NACHT Kdo TetR_C_24 AAA_5
Motif
Other DBs
NCBI-GeneID: 3094463
NCBI-ProteinID: YP_107226
UniProt: Q63XD9
LinkDB All DBs
Position
1:668159..672238
Genome map
AA seq 1359 aa AA seqDB search
MSASVLAERARAGNRRAPRALAPPLPGDGDELQGEHRYRLGAVLGEGGAGRVHEAIRLDT
SARVAIKLLREDAPRGARERARLRARFRRETALCARLSHPHIVALLDSGETPDGLLFAVF
EHVAGRTLRALLAADGALAAETTGALMAQVLDGLAHAHANGVVHRDLKPQNVMVTTRDGE
PCAKILDFGIGALLPDAHAADELTLTATTEVLGSPQYCAPEQLRGEPPTAKSDFYAWGLI
VIECLTGHPVMQGASLADVLYQHLSPVDVALPPAIAAHPLGDVLRDALNKDPRQRAESAQ
ALANRFRAIHFPALVGGLRYGARHGRRAQAEPGVAAREPGGTIALDAPVGRRQVTALCCR
VSVVSTLARPADAAADDEALDAFHAHWLTRCSDIAVRYGGHVAGALGDTLLFYFGYPEGI
DRPAQRACRAALEMTRHAGQPAGAPRSSDGDARACAPAWRIDIAGAIHVGTAFATARGAS
GGVLASAALGLQRIAQPGGILLSDEAARALERHVDAAPTALTFAAPGAAPQPVRELLGER
YERGPFESLELGDATPIVGRDREQAALARAWRDAVRAAAGGRRARRRATLVVGEPGIGKS
RLVHALRELVRAQRGACAACVCLPEQTNHALFPILRFVRAHWQLDVGDPHALDRMLEAFD
GDRASARATLAAWLGLPGGADTLRWSGARQQQALFDVLCQLLGSLGGGGPVLLIVDDVQW
CDSATDDFLDALAHHPACAAVCVVLTSRPERLERWRRGAERLMLRRLSAAATRNLIVSLM
PGAGTQRAALDFLVKRTGGVPLYVEETVRALAEGGVAPGAGARLPDLAQAGRCPLPGSLR
ETLELALERADDALDTVQLAATIGLEVDARLLAEASPHAGAELDERLRRLIEGRVLYAQH
RIGGATYVFRHALLREAAYESMPAATRREYHRRVAQALLACVAQGDPAARSASIADHFAR
AHAFAAAVPHGIEAARRALARALHDDAIRYAGAVRGWLLHCDYPGQHEDAVSVDLTLAHA
QMARDGWGDPRVREHTDRVLSRVGELSDAKAAAGALWTIAVYHHVAGDRDAVRRIGGQLS
ALARASARADLGVAADTLHGMALWIDGHYTLALDAFDAALAAYDPRRDGDHRHVFGLDTR
AWAQSARACVLWGIDDDVARTLALARDAVQLATCTDHLPTIGLTMMYLARMQQCVGDREG
ARATADAVLRLSRCHGLNAVERYAAVVRAWCDGDRDAARANVDALRASGCMLGLTYYASV
AADIDAERGDARAALATLDECLALAESMDERHYVAELLLKKARCVRDAHGRRAADDAQAL
CARAAAVARRSGMARIERKAQAELRELQRELRSTTGEER
NT seq 4080 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcttccgttctggccgaacgcgcgcgcgccggcaatcgccgtgcgccgcgcgcg
ctcgcgccgccgctgcccggcgacggcgacgaactgcaaggcgagcatcgctaccggctc
ggcgccgtgctcggcgaaggcggcgcgggccgcgtgcacgaggcgatccggctcgacacg
tcggcgcgcgtcgcgatcaagctgctgcgcgaggatgcgccgcgcggcgcgcgcgagcgc
gcccggctgcgcgcgcgctttcgccgcgagacggcgctgtgcgcacggctgtcgcatccg
cacatcgtcgcgctgctcgacagcggcgagacgccggacggcctgctgttcgcggtgttc
gagcacgtcgccgggcgcacgctgcgcgcgctgctcgcggccgacggcgcgctggccgcc
gagacgacgggcgcgctgatggcgcaggtgctcgacggcctcgcgcacgcgcatgcgaac
ggcgtcgtgcatcgtgacctgaagccgcagaacgtgatggtgacgacgcgcgacggcgag
ccgtgcgcgaagatcctcgacttcggaatcggcgcgctgctgcccgatgcgcatgccgcc
gacgaactgacgctcaccgcgacgaccgaggtgctcggctcgccgcagtactgcgcgccg
gagcaattgcgcggcgagccgccgaccgcgaaaagcgatttctacgcgtggggcctgatc
gtcatcgaatgcctgaccgggcatccggtgatgcagggcgcgagcctcgcggacgtgctg
tatcagcatctgagccccgtcgacgtcgcgctgccgcccgcgatcgccgcgcatccgctc
ggcgacgtgttgcgcgatgcgctgaacaaggatccgcggcagcgcgcggaatccgcgcag
gcgctcgccaaccggttccgcgcgatccacttcccggcgctcgtcggcggcctgcgctac
ggcgcgcgtcacgggcggcgcgcgcaggcggagccgggcgtcgcggcccgcgagccgggc
gggacgatcgcgctcgacgcgcccgtcgggcggcgtcaggtgacggcgctctgctgccgc
gtgtcggtcgtctcgacgctggcgcggccggccgacgcggcggccgacgacgaagcgctc
gacgcgtttcacgcgcactggctcacgcgctgctcggacatcgcggtgcgctacggcggc
cacgtcgcgggcgcgctcggcgatacgctgctgttctacttcggctaccccgaggggatc
gatcgccccgcgcagcgcgcgtgccgcgcggcgctcgagatgacgcggcacgcggggcag
ccggcgggcgcgccgcgttcgtccgacggcgacgcgcgtgcgtgcgcgcccgcgtggcga
atcgacatcgcgggcgcgatccatgtcggcacggcgttcgcgaccgcgcgcggcgcgtcg
ggcggcgtgctcgcgagcgcggcgctcggcctgcagcgcatcgcgcagccgggcggcatt
ctgttgagcgacgaagcggcgcgcgcgctcgagcgccacgtcgacgccgcgccgactgcg
ctcacgttcgccgcgcccggcgcggcgccgcagccggtgcgcgagctgctcggcgagcgc
tacgagcgcgggccgttcgaatcgctcgaactcggcgacgcgacgccgatcgtcgggcgc
gatcgcgagcaggcggcgctcgcgcgcgcatggcgcgatgcggtgcgcgcggcggcgggc
gggcgtcgcgcgcggcggcgcgcgacgctcgtcgtcggcgagccgggcatcggcaaatcg
cggctcgtgcatgcgctgcgcgagctggtgcgcgcgcagcgcggcgcgtgtgcggcatgc
gtgtgcctgcccgagcagacgaatcacgcgctttttccgatcctgcgtttcgtgcgcgcg
cactggcagctcgatgtgggcgatccgcacgcgctcgaccggatgctcgaagcgttcgac
ggcgatcgcgcatccgcgcgcgcgacgcttgccgcgtggctcggcctgccgggcggcgcg
gatacgctgcgctggtcgggcgcgcggcagcagcaggcgcttttcgacgtgctgtgccaa
ctgctcggctcgctcggcggcggcggtcccgtgctgctgatcgtcgacgacgtgcaatgg
tgcgacagcgcgacggacgattttctcgacgcgctcgcgcaccacccggcgtgcgcggcg
gtgtgcgtcgtgctgacgtcgcggccggagcggctcgagcgctggcggcgcggcgccgaa
cgcctgatgctgcgccgcctgtcggctgccgcgacgcgcaatctgatcgtgtcgctgatg
cccggcgcgggcacgcagcgcgcggcgctcgattttctcgtgaagcgcacgggcggcgtg
ccgctgtacgtggaggaaacggtccgcgcgctcgccgaaggcggcgttgcgccgggcgcg
ggcgctcggctgcccgatctcgcgcaggcggggcgttgcccgctgccgggcagcctgcgc
gagacgctcgagctcgcgctcgaacgcgcggacgacgcgctcgataccgtgcagctcgcc
gcgacgatcggcctcgaggtggacgcgcggctgctcgccgaagcgtcgccgcacgcgggc
gcggaactggacgagcggttgcggcggctgatcgaaggccgcgtgctgtacgcgcagcac
cgcatcggcggcgcgacgtacgtgttccgtcacgcattgctgcgcgaggccgcatacgaa
tcgatgccggccgcgacgcgccgcgaatatcatcggcgcgtcgcgcaggcgctgctcgcg
tgcgtcgcgcagggcgatccggcggcgcgctcggcgagcatcgccgatcacttcgcgcgt
gcgcacgcgttcgccgccgcggtgccgcacggcatcgaagccgcgcgccgcgcgctcgcg
cgtgcgctgcacgacgacgcgatccgctatgcgggcgcggtgcgcggctggctgctgcat
tgcgactacccggggcagcacgaggatgcggtatcggtcgacctgacgctcgcgcacgcg
cagatggcgcgcgacggctggggcgatccgcgcgtgcgcgagcataccgaccgcgtgctg
tcgcgcgtcggcgagctgagcgacgcgaaggcggccgcgggcgcgttgtggacgatcgcg
gtgtatcaccacgtcgccggcgatcgcgacgcggtgcgccgcatcggcgggcaactgtcg
gcgctcgcgcgcgcgtccgcgcgcgcggatctcggcgtcgcggccgatacgctgcacggc
atggcgctctggatcgacggccactacacgctcgcgctcgacgcgttcgacgcggcgctc
gccgcgtacgatccgcgccgcgacggcgatcaccggcacgtgttcggcctggacacgcgc
gcgtgggcgcaatccgcgcgcgcgtgcgtgctgtggggcatcgacgacgatgtcgcgcgc
acgctcgcgctcgcgcgcgacgcggttcaactggcgacctgcaccgatcatctgccgacg
atcggcctgacgatgatgtatctcgcgcgaatgcagcaatgcgtgggcgaccgggaaggc
gcgcgcgcgacggccgacgcggtgctgcggctgtcgcgctgccacgggctcaacgcagtc
gagcgctacgcggccgtcgtgcgggcgtggtgcgacggcgatcgcgacgcggcgcgcgcg
aacgtcgatgcgctgcgcgcgtcgggatgcatgctgggcctcacgtattacgcgtcggtc
gccgccgacatcgacgccgagcgcggcgatgcgcgcgccgcgctcgcgacgctcgacgaa
tgcctcgcgctcgccgaatcgatggacgagcgccattacgtcgccgaactgctgctcaag
aaggcgcgctgcgtgcgcgacgcgcacggccgccgcgcggccgacgacgcccaagcgctg
tgcgcgcgggccgccgccgtcgcgcggcgcagcggcatggctcgaatcgagaggaaagcg
caggcggagctgcgcgagctgcaacgggaactccgatcaaccacgggagaagagcgatga

DBGET integrated database retrieval system