KEGG   Burkholderia pseudomallei K96243: BPSL0688Help
Entry
BPSL0688          CDS       T00203                                 

Gene name
glpD
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00564  Glycerophospholipid metabolism
bps01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bps00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BPSL0688 (glpD)
Enzymes [BR:bps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BPSL0688 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 Pyr_redox_2 FAD_oxidored NAD_binding_8 3HCDH_N FAD_binding_2
Motif
Other DBs
NCBI-GeneID: 3093043
NCBI-ProteinID: YP_107317
UniProt: Q63X49
LinkDB All DBs
Position
1:complement(784486..786018)
Genome map
AA seq 510 aa AA seqDB search
MTQQNRYDLLVVGGGINGAGIARDAAGRGLSVLLCEQDDLASHTSSSSTKLIHGGLRYLE
YKEFGLVRKALQERETLLRAAPHIMWPLRFVMPHMPNLRPAWLIRVGLFLYDHLAKRELL
PGSRGIDMRRHPAGAPLVDSIKRGFVYSDGWVDDARLVVLNALDAQERGARILTRTKLVS
AERRDGQWHARLQRADGSTLDVRARAIANAAGPWVGEVLHGALGRGAQHSVRLVKGSHII
TPRLFDHDHAYIFQNPDKRIIFAIPYERDFTLIGTTDVEYRDDPSRVAIDRDETRYLCES
INRYFKRKISPADVCWTYSGVRPLLEDENADNPSAVTRDYRLELDDGEGAPLLSVFGGKI
TTFRKLAEEATDMLGGALGAARGAWTAGVPLPGGDIANARFAPFAEAFAKRHPWLPAALA
RRYARAYGTRAERVIGRARSLAELGEQLAPGLYEAELRYLRDVEWAGCADDVLWRRSKLG
LHVAPGTLEPVTAALDAWFGAAREAASAAH
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
gtgactcaacagaatcgttacgatctgctcgtcgtcggcggcgggatcaacggcgcgggc
atcgcgcgcgatgcggccggccgcggcctgtcggtgctcctttgcgagcaggacgacctc
gcgtcgcacacctcctcttcgagcacgaagctgatccacggcgggttgcgctacctcgaa
tacaaggaattcgggctcgtgcgcaaggcgctgcaggaacgcgaaacgctgctgcgcgcg
gcgccgcacatcatgtggccgctgcgcttcgtgatgccgcacatgccgaacctgcgcccc
gcgtggctcatccgggtcggcctcttcctgtacgaccatctcgcgaaacgcgagctgctg
ccgggctcgcgcggcatcgacatgcgccgccatccggcgggcgcgccgctcgtcgattcg
atcaagcgcggcttcgtctattcggacggctgggtcgacgatgcgcggctcgtcgtgctg
aacgcgctcgatgcgcaagagcgcggcgcgcgcatcctcacgcgcacgaagctcgtgtcg
gccgagcgccgcgacgggcaatggcatgcacgactgcaacgcgccgacggctcgacgctc
gacgtgcgggcgcgcgcgatcgcgaacgcggcgggcccgtgggtcggcgaagtgctgcac
ggcgcgctcggccgcggcgcgcagcatagcgtgcgcctcgtgaaaggcagccacatcatc
acgccgcgcctgttcgatcacgaccacgcatacatcttccagaatccggacaagcgcatc
atcttcgcgattccgtacgaacgcgacttcacgctgatcggcacgaccgacgtcgaatac
cgcgacgatccgtcgcgcgtcgcgatcgaccgcgacgaaacgcgctatctgtgcgagtcg
atcaaccgctatttcaagcgtaagatctcgcccgccgacgtgtgctggacctactccggc
gtgcgcccgctgctcgaggacgagaacgcggacaacccgtccgccgtcacgcgcgactac
cgcctcgagctcgacgacggcgaaggcgcgccgctgctgtcggtgttcggcggcaagatc
acgacgtttcgcaagctcgccgaagaggcgaccgacatgctgggcggcgcgctcggcgcg
gcgcgcggcgcatggacggcgggggtgccgctgccgggcggcgacatcgcgaacgcgcgc
ttcgcgccgttcgccgaggcgttcgcgaaacgccacccgtggctgcccgccgcgctcgcg
cgccgctatgcgcgcgcgtacggcacgcgcgccgagcgcgtgatcgggcgggcccggtcg
ctcgccgagctcggcgagcagctcgcgcccggcctctacgaagcggaattgcgttatctg
cgcgacgtcgaatgggcgggttgcgcggacgacgtgctgtggcggcgttcgaagctcggc
ctgcatgtcgcgccgggcacgctcgagcccgtgacggccgcgctcgacgcctggttcggc
gccgcgcgcgaagcggcgagcgccgcgcactga

DBGET integrated database retrieval system