KEGG   Burkholderia pseudomallei K96243: BPSL0880Help
Entry
BPSL0880          CDS       T00203                                 

Gene name
sodB
Definition
(RefSeq) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bps  Burkholderia pseudomallei K96243
Brite
Enzymes [BR:bps01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BPSL0880 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 3094563
NCBI-ProteinID: YP_107505
UniProt: Q63WL1
LinkDB All DBs
Position
1:1020489..1021067
Genome map
AA seq 192 aa AA seqDB search
MAHTLPPLPYAEDALAPHISQETIQFHYGKHHQAYVTNLNNLIPGTEFENLPLEEIVKKS
SGGIFNNAAQIWNHTFFWNSLSPNGGGAPTGALGDAINAKWGSFDAFKEAFTKAAVGTFG
SGWAWLVKKADGSLDIVSTSNAATPLTTADKPLVTIDVWEHAYYIDYRNARPKFVEAFWN
IVNWDFAAKNFA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggctcatacgctcccgccgctgccgtacgctgaagacgccctcgctccgcatatctcg
caggagacgatccagtttcactacggcaagcatcaccaggcttatgtgacgaacctgaac
aacctgatccccggcaccgagttcgagaacctgccgctggaagagatcgtgaagaagtcg
tcgggcggcatcttcaacaacgccgcgcagatctggaatcacacgttcttctggaacagc
ctgtcgccgaacggcggcggcgcgccgacgggcgcgctcggcgacgcgatcaacgcgaag
tggggttcgttcgacgcgttcaaggaggcgttcacgaaggcagcggtcggcacgttcggc
tcgggctgggcttggctcgtgaagaaggcggacggctcgctcgacatcgtgtcgacgagc
aatgcggccacgccgctcacgacggccgacaagccgctcgtcacgatcgacgtgtgggaa
cacgcttactacatcgattaccgcaacgcgcgcccgaagttcgtcgaagcgttctggaac
atcgtgaactgggacttcgccgcgaagaacttcgcgtaa

DBGET integrated database retrieval system