KEGG   Burkholderia pseudomallei K96243: BPSL1238Help
Entry
BPSL1238          CDS       T00203                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bps00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BPSL1238
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bps02000]
    BPSL1238
Enzymes [BR:bps01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BPSL1238
Transporters [BR:bps02000]
 Other Transporters
  Pores ion channels [TC:1]
   BPSL1238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-GeneID: 3093261
NCBI-ProteinID: YP_107859
UniProt: Q63VK7
LinkDB All DBs
Position
1:1422330..1423004
Genome map
AA seq 224 aa AA seqDB search
MMKETSMLRLCGFPVSNYYNKVKFVLLEHDIPFEASIVSVPIKDPAFLADTPLGKVPYLM
TEHGSLCESQAIIEYLAAIHPDKPIFPADPFAAAKAREITAVLELYLEWNVRELFPEAFF
GGKVSDGTKAHVEKRMPRALDGFKRLAKFSPYVLGDTFCIADIAAFIHLPVVALATKAIY
GRDFVVDAGIDWKAYVKRIEEARPAAKRVSDERKAFVAGLAKPG
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaggagacttcgatgctgcggctttgtggttttccagtgtccaattattacaac
aaggtcaagttcgtcctgctcgagcacgacattccgttcgaagcgtcgatcgtcagcgtc
ccgatcaaggaccccgcgtttttggccgatacgccgctcggcaaggtgccgtatctgatg
accgagcacggctcgctgtgcgaatcgcaggcgatcatcgaatatcttgccgcgattcat
cccgacaagcccattttcccggccgatccgttcgcggcggcgaaggcgcgcgagatcacg
gcggtgctcgagctgtacctcgaatggaacgtgcgcgaactgtttccggaggcgttcttc
ggcggcaaggtgagcgacggcacgaaggcgcacgtcgagaagcgcatgccgcgcgcgctg
gacggtttcaagcggctcgcgaaattttcgccgtacgtgctcggcgatacgttctgcatt
gccgacatcgccgcgttcatccatctgccggtcgtcgcgctcgcgacgaaggcgatctac
ggccgcgatttcgtcgtcgacgcggggatcgactggaaggcgtacgtgaagcgcatcgag
gaagcgcggccggccgcgaagcgcgtgagcgacgagcgcaaggcgttcgtcgcggggctc
gcgaagccgggctga

DBGET integrated database retrieval system