KEGG   Burkholderia pseudomallei K96243: BPSL1883Help
Entry
BPSL1883          CDS       T00203                                 

Definition
(RefSeq) acyl-CoA synthetase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00061  Fatty acid biosynthesis
bps00071  Fatty acid degradation
bps01100  Metabolic pathways
bps01212  Fatty acid metabolism
bps02024  Quorum sensing
Module
bps_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:bps00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BPSL1883
   00071 Fatty acid degradation
    BPSL1883
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BPSL1883
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bps01004]
    BPSL1883
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bps04147]
    BPSL1883
Enzymes [BR:bps01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     BPSL1883
Lipid biosynthesis proteins [BR:bps01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   BPSL1883
Exosome [BR:bps04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   BPSL1883
  Exosomal proteins of breast cancer cells
   BPSL1883
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2 Raffinose_syn
Motif
Other DBs
NCBI-GeneID: 3094522
NCBI-ProteinID: YP_108482
UniProt: Q63TT4
LinkDB All DBs
Position
1:2242630..2244402
Genome map
AA seq 590 aa AA seqDB search
MTAPVAPAHAHTHAPNTDGIWYASYPKGVPHDIDVTRYESLAQYFDECTTRYAQRVAFIS
AGARMTYAALARKAAAFASYLQSLGVKPGDRVAIMLPNTFQYPVTLFGTLKAGAIVVNVN
PLYTARELAHQLKDSGAQTIIVFENFAKTLQDALPETQIKHVVVTALGDLLADGLNPKGR
LINFVLKHVKKLVPAYRLPQAVRLRAALAAGAKKAPAPVALKRDDLAFLQYTGGTTGVAK
GAMLTHGNLIANLLQAKAWIEDQLTGDVETVLTPLPLYHIYSLTVNAFIFLGLGGRNILI
ANPRDTKTMMKILRHETFTGITGINTLYNAFLDNEEFRKRDFSKLKLAMAGGMAMQRAVA
ERFEQVTGCPIVEGYGLTECSPIVTMNPYDAHEKRAFSGTIGLPAPSTIVRFRTEDGAWA
NVGEPGELCVHGPQVMRGYWQRPDETAKVIDADGWLATGDIGVMDEQGFIRLIDRKKDMI
LVSGFNVYPNEIEDVLVSHPGIREAAAIGIPDPVHGERIKVFVVPRDASLTVEDVLTHCR
KNLTGYKMPKAVEFRDALPQTNVGKILRRALRDEELAKLANAPADPHAKH
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccccgttgcgcccgcccacgcccacacgcatgcgccgaataccgacggcatc
tggtacgcgtcgtacccgaaaggcgtgccgcacgacatcgatgtcacgcggtacgaatcg
ctcgcgcagtacttcgacgaatgcacgacccgctatgcgcaacgcgtcgccttcatcagc
gcgggcgcgcggatgacctacgcggcgctcgcgcgcaaggcggccgcgttcgcctcgtat
ctgcaaagcctcggcgtgaagccgggcgatcgcgtcgcgatcatgctgccgaacacgttc
cagtatccggtcacgctgttcggcacgctgaaggccggcgcgatcgtcgtcaacgtgaat
ccgctctacaccgcgcgcgagctcgcgcaccagttgaaggacagcggcgcgcagacgatc
atcgtgttcgagaacttcgcgaagacgctgcaggacgcgctgcccgagacgcagatcaag
cacgtcgtcgtgaccgcgctcggcgacctgctcgccgacggtctcaatccgaaaggccgg
ctgatcaacttcgtgctcaagcacgtgaagaagctcgtgccggcgtaccggctgccgcag
gccgtgcgcctgcgcgcggcgctcgcggccggcgcgaaaaaggcgcccgcgcccgtcgcg
ctcaagcgcgacgatctcgcgttcctgcagtacacgggcggcacgacgggcgtcgcgaaa
ggcgcgatgctcacgcacggcaatctgatcgcgaacctgctgcaagcgaaggcatggatc
gaggatcagctcacgggcgacgtcgagacggtgctcacgccgctgccgctctatcacatc
tattcgctgacggtgaacgcgttcatcttcctcggcctcggcgggcgcaacatcctgatc
gcgaatccgcgcgacacgaagacgatgatgaagatcctgcgtcacgagaccttcacgggc
atcaccggcatcaacacgctctacaacgcgttcctcgacaacgaggaattccgcaagcgc
gacttctcgaagctcaagctcgcgatggcgggcggcatggcgatgcagcgcgcggtcgcc
gagcgcttcgagcaggtgaccggctgcccgatcgtcgaaggctacgggctcaccgaatgc
tcgccgatcgtcacgatgaacccgtacgacgcgcacgaaaagcgtgcattcagcggcacg
atcggcctgcccgcgccgtcgacgatcgtgcgctttcgcacggaggacggcgcatgggcg
aacgtcggcgagccgggcgagctgtgcgtgcatgggccgcaggtgatgcgcggctactgg
cagcgccccgacgagaccgcgaaagtgatcgacgccgacggctggctcgcgacgggcgac
atcggcgtgatggacgagcaaggcttcatccgcctgatcgaccgcaagaaggacatgatt
ctcgtatcgggcttcaacgtgtatccgaacgagatcgaagacgtgctcgtgtcgcatccg
ggcatccgcgaagcggcggcgatcggcattcccgatcccgttcacggcgagcgcatcaag
gtgttcgtcgtgcctcgcgacgcatcgctgacggtcgaggacgtgctcacgcactgccgc
aagaacctgacgggctacaagatgccgaaggccgtcgaattccgcgacgcgctgccgcag
accaacgtcggcaagatcctgcgccgcgcgctgcgcgacgaggaactcgcgaagctcgcg
aacgcgcccgccgatccgcacgcgaagcactga

DBGET integrated database retrieval system