KEGG   Burkholderia pseudomallei K96243: BPSL1908Help
Entry
BPSL1908          CDS       T00203                                 

Gene name
sucB
Definition
(RefSeq) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00020  Citrate cycle (TCA cycle)
bps00310  Lysine degradation
bps00380  Tryptophan metabolism
bps01100  Metabolic pathways
bps01110  Biosynthesis of secondary metabolites
bps01120  Microbial metabolism in diverse environments
bps01130  Biosynthesis of antibiotics
bps01200  Carbon metabolism
Module
bps_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bps_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BPSL1908 (sucB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    BPSL1908 (sucB)
   00380 Tryptophan metabolism
    BPSL1908 (sucB)
Enzymes [BR:bps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BPSL1908 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 3093009
NCBI-ProteinID: YP_108508
UniProt: Q63TQ8
LinkDB All DBs
Position
1:complement(2270344..2271621)
Genome map
AA seq 425 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV
LQNDGDTVVADQVIATIDTEAKAGAAAAAAGAADVQPAAAPVAAPAPAAQPAAAAASSTA
AASPAASKLMAEKGIGAGDVAGSGRDGRITKGDVLSAGSAPKAAPAAAPAKAAAKPALPE
VKVPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVMDLRAKY
KDKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLV
VPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINP
PQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPAR
LLLDL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagctttcggagtcggtttcggaagcgaccatg
ctgcagtggaagaagaagcccggcgaagccgtcgcgcaggacgaaatcctgatcgagctc
gagacggacaaggtcgtcctcgaagtgccggcgccggccgcgggcgtgctcgcgcaggtg
ctgcagaacgacggtgacacggtcgtcgccgaccaggtgatcgcgaccatcgacaccgaa
gcgaaggcaggcgccgccgcggcagcggcaggcgccgccgacgttcagccggccgccgct
cccgtcgccgcgccggcgcccgccgcacagccggccgccgccgccgcgtcgagcaccgcg
gccgcatcgcccgccgcgtcgaagctgatggccgagaagggcatcggcgccggcgacgtc
gccggctcgggccgcgacggccgcatcacgaagggcgacgtgctgtccgcgggcagcgcg
ccgaaggccgcgccggccgccgcgccggcgaaggccgccgcgaagccggcgctgccggaa
gtgaaggtgccggcatcggcgacgacgtggctcaacgaccgtccggagcagcgcgtgccg
atgtcgcgcctgcgcgcgcgcatcgccgagcgtctgctcgaatcgcagcagaccaacgcg
atcctcacgacgttcaacgaagtgaacatgcagccggtgatggacctgcgcgcgaagtac
aaggacaagttcgagaaggagcacggcgtgaagctcggcttcatgtcgttcttcgtgaag
gcagccgttcacgcgctgaagaagttcccgctcgtgaacgcgtcgatcgacggcaacgac
atcgtctaccacggctacttcgacatcggcatcgcggtcggttcgccgcgcggcctcgtc
gtgccgatcctgcgcaacgcggatcagctgagcctcgccgagatcgagaagaagatcgcc
gaattcggccagaaggcaaaggacggcaagctgtcgatcgaggaaatgacgggcggcacg
ttctcgatctcgaacggcggcgtgttcggctcgatgctgtcgacgccgatcatcaacccg
ccgcagtcggcgatcctcggcgtgcacgcgacgaaggagcgcccggtcgtcgagaacggc
cagatcgtgatccgcccgatcaactatctcgcgctgtcgtacgaccaccggatcatcgac
ggtcgcgaagcggtgctgtcgctcgtcgcgatgaaggacgcgctcgaagatccggcgcgc
ctgctgctcgacctgtaa

DBGET integrated database retrieval system