KEGG   Burkholderia pseudomallei K96243: BPSL2953Help
Entry
BPSL2953          CDS       T00203                                 

Gene name
tktA
Definition
(RefSeq) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00030  Pentose phosphate pathway
bps00710  Carbon fixation in photosynthetic organisms
bps01100  Metabolic pathways
bps01110  Biosynthesis of secondary metabolites
bps01120  Microbial metabolism in diverse environments
bps01130  Biosynthesis of antibiotics
bps01200  Carbon metabolism
bps01230  Biosynthesis of amino acids
Module
bps_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bps_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BPSL2953 (tktA)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BPSL2953 (tktA)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    BPSL2953 (tktA)
Enzymes [BR:bps01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     BPSL2953 (tktA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N TPP_enzyme_C E1_dh
Motif
Other DBs
NCBI-GeneID: 3094803
NCBI-ProteinID: YP_109547
UniProt: Q63QS1
LinkDB All DBs
Position
1:complement(3524452..3526479)
Genome map
AA seq 675 aa AA seqDB search
MTTSSPASTTLMANAIRALAMDAVQQANSGHPGMPMGMAEIGVALWSRHLKHNPTNPHWA
DRDRFVLSNGHGSMLLYSLLHLTGYDLPIEELKNFRQLHSKTPGHPEYGITPGVETTTGP
LGQGLANAVGMALGEALLAAEFNRDDAKIVDHHTYVFVGDGCLMEGISHEACSLAGTLKL
NKLIAFYDDNGISIDGDVVNWFHDDTPKRFEAYGWNVIPNVNGHDVDAVDAAIAKAKSAD
KPTLICCKTVIGKGAATKAGGHDVHGAALGAEEIAKTRDALGWKWAPFVIPQEVYAAWDA
KEAGKRREGDWNAAFAQYRAKYPAEAAEFERRMAGKLPADWAEKAAAIVAGANERGETVA
TRKASQQTIEGLAAVLPELLGGSADLTGSNLTNWKASKAVRANAHGAGIQWGNHINYGVR
EFGMSAAINGLVLHGGYKPFGGTFLTFSDYSRNALRVAALMKVPSIFVFTHDSIGLGEDG
PTHQSVEHVASLRLIPNLDVWRPADTVETAVAWTHAVSHQHPSCLVFSRQNLAFNARTDA
QLANIEKGGYVLRDWDEEIVARKIILIATGSEVELAMKAVEPLAQQGIAARVVSMPSTDV
FDRQDAEYRERVLPHGVRRVAIEAGVTDFWRKYVGLEGGVVGIDTFGESAPAGVLFKHFG
FTIEHVVETAKAVLA
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgacgacttcgtctcccgcctccaccactctgatggccaacgcgatccgcgcgctcgcg
atggacgccgtccagcaagcgaactccggccaccccggcatgccgatgggcatggccgag
atcggcgtcgcgctgtggtcgcgccacctgaagcacaacccgacgaacccgcattgggcc
gaccgcgaccgcttcgtgctgtcgaacggccacggctcgatgctgctgtactcgctgctg
cacctgacgggctacgatctgccgatcgaagagctgaagaatttccggcaattgcattcg
aagacgccgggccacccggaatacgggatcacgccgggcgtcgagacgacgacgggcccg
ctcggccagggcctcgcgaacgcggtcggcatggcgctcggcgaggcgctgctcgccgcc
gagttcaaccgcgacgacgcgaagatcgtcgatcatcacacgtacgtgttcgtcggcgac
ggctgcctgatggagggcatctcgcacgaagcgtgctcgctcgcgggcacgctcaagctc
aacaagctgatcgcgttctacgacgacaacgggatctcgatcgacggcgacgtcgtcaac
tggttccacgacgacacgccgaagcgcttcgaggcgtacggctggaacgtgattccgaac
gtgaacggccacgacgtcgacgcggtcgatgccgcgatcgcgaaggcgaagagcgcggac
aagccgacgctcatctgctgcaagacggtgatcggcaagggcgcggcgacgaaggcgggc
ggccacgacgtgcacggcgcggcgctcggcgcggaggaaatcgcgaagacgcgcgacgcg
ctcggctggaagtgggcgccgttcgtgattccgcaggaagtctacgcggcgtgggacgcg
aaggaagcgggcaagcgccgcgaaggcgactggaacgcggcgttcgcgcagtaccgcgcg
aagtacccggccgaggccgccgaattcgagcgccgcatggcgggcaagctgccggccgac
tgggccgagaaggccgcggcgatcgtcgccggcgcgaacgagcgcggcgagacggtcgcg
acgcgtaaggcgtcgcagcagacgatcgagggccttgccgccgtgctgcccgagctgctc
ggcggctcggccgacctgacgggctcgaacctcacgaactggaaggcgtcgaaggcggtg
cgcgcgaatgcgcacggtgcgggcatccagtggggcaaccacatcaactacggcgtgcgc
gaattcggcatgagcgccgcgatcaacggcctcgtgctgcacggcggctacaagccgttc
ggcggcacgttcctcacgttctccgactacagccgcaacgcgctgcgcgtcgccgcgctg
atgaaggtgccgtcgatcttcgtgttcacgcacgattcgatcggcctcggcgaagacggg
ccgacgcaccagtcggtcgagcacgtcgcgagcctgcggctgattccgaacctcgacgtc
tggcgcccggccgacacggtcgagacggcggtcgcgtggacccacgcggtctcgcaccag
cacccgtcgtgcctggtcttcagccgccagaacctcgcgttcaacgcgcgcaccgacgcg
cagctcgcgaacatcgagaagggcggctacgtgctgcgcgactgggacgaagagatcgtc
gcgcgcaagatcatcctgatcgcgacgggctcggaagtggagctcgcgatgaaggcggtc
gagccgctcgcgcagcaggggatcgccgcgcgcgtcgtgtcgatgccgtcgaccgacgtg
ttcgaccggcaggacgccgagtaccgcgagcgcgtgctgccgcacggcgtgcgccgcgtc
gcgatcgaagcgggcgtcaccgatttctggcgcaagtacgtgggcctcgaaggcggcgtg
gtcggcatcgacacgttcggcgagtcggctccggctggcgtgttgttcaagcatttcggc
ttcacgatcgagcacgtggtcgaaacggcgaaggcggtgctcgcgtaa

DBGET integrated database retrieval system