KEGG   Burkholderia pseudomallei K96243: BPSS0171
Entry
BPSS0171          CDS       T00203                                 

Definition
(RefSeq) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bps00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BPSS0171
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bps02044]
    BPSS0171
Secretion system [BR:bps02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPSS0171
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-GeneID: 3096593
NCBI-ProteinID: YP_110192
UniProt: Q63NX7
LinkDB
Structure
PDB: 
4TV4

Position
2:complement(228834..229319)
AA seq 161 aa
MAQDIFLKIDGINGESLDDSHKDEIEVLNWNWEIQQESTMHTGSGGGAGKASVKDLTFEH
AIDRASPNLMKYALTGKHVDQAVLVMRKAGGNPLEYLKLTMSDVIITRVRPSGSRDDTER
SRETVSLSFAKVKQEYVVQNAQGGSGGAVTTSFDIKGNKEA
NT seq 486 nt   +upstreamnt  +downstreamnt
atggcgcaggatatttttctgaagatcgacggcatcaacggtgaatccctcgacgacagc
cacaaggacgagatcgaagtcctgaactggaactgggagattcagcaggaatcgacgatg
cacacgggcagcggcggcggcgccggcaaggcgagcgtgaaggatctgacgttcgagcac
gcgatcgaccgcgcgagccccaacctgatgaagtacgcgctgaccggcaagcacgtcgat
caggcggtgctcgtgatgcgcaaggcgggcggcaatccgctcgaatacctgaagctcacg
atgagcgacgtgatcatcacgcgcgtgcggccgtcgggcagccgcgacgacaccgagcgc
agccgcgagacggtatcgctgtcgttcgcgaaggtgaagcaggagtatgtcgtgcagaac
gcgcagggcggcagcggcggcgccgtcacgacgagcttcgacatcaagggcaacaaggaa
gcctga

DBGET integrated database retrieval system