KEGG   Burkholderia pseudomallei K96243: BPSS0281Help
Entry
BPSS0281          CDS       T00203                                 

Gene name
gabT
Definition
(RefSeq) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00250  Alanine, aspartate and glutamate metabolism
bps00410  beta-Alanine metabolism
bps00640  Propanoate metabolism
bps00650  Butanoate metabolism
bps01100  Metabolic pathways
bps01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BPSS0281 (gabT)
   00650 Butanoate metabolism
    BPSS0281 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BPSS0281 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BPSS0281 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bps01007]
    BPSS0281 (gabT)
Enzymes [BR:bps01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BPSS0281 (gabT)
Amino acid related enzymes [BR:bps01007]
 Aminotransferase (transaminase)
  Class III
   BPSS0281 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 3095139
NCBI-ProteinID: YP_110301
UniProt: Q63NL8
LinkDB All DBs
Position
2:complement(375588..376871)
Genome map
AA seq 427 aa AA seqDB search
MNNADLHARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRHPR
IVKAIADQLGQFTHTAYQIVPYASYVELAEKINARAPIAQPKKTAFFTTGAEAVENAVKI
ARAYTGRPGVIAFAGGFHGRTMMGMALTGKVAPYKIGFGPFPGDVFHAPYPNALHGVTSA
DSIAAVETLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVRALRKLCDAHGILLIADEV
QTGFARTGKLFAMEHYDVSADLMTIAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYAGN
PLAVAAAHAVLDVIDEEKLAERATVLGDKLKAKLAALRAELPQIVDVRGPGAMVAAEFVD
PHTRASDAAFTKRVQTLALERGLLLLICGVDANVIRFLFPLTIEDAVFDEALGILESVLR
EAVGVPA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaatgccgatctgcacgcccgcaagaacgccgcgacgccgcgtggcgtcggcgtg
atgtgcgatttctacgcggcacgcgccgagaacgccgagctgtgggatgtcgagggccgc
cgcttcatcgatttcgcggccggcatcgcggtcctgaacacgggccatcgccatccgagg
atcgtgaaggcgatcgccgaccagctcgggcaattcacgcataccgcgtatcagatcgtg
ccgtacgcgtcgtacgtcgagctcgccgagaagatcaacgcgcgcgcgccgatcgcgcag
ccgaagaagaccgcgttcttcacgacgggcgcggaagcggtcgagaacgcggtgaagatc
gcgcgcgcctacaccggccggccgggcgtgatcgcgttcgcgggcggcttccacggccgc
acgatgatgggcatggcgctcaccggcaaggtcgcgccgtacaagatcggcttcggcccg
ttcccgggcgacgtgttccacgcgccgtacccgaacgcgttgcacggcgtgacgagcgcc
gattcgatcgcggccgtcgaaacgctgttcaaggccgacatcgatccgaagcgcgtcgcc
gcgatcatcttcgagccggtgcagggcgaaggcggcttcaacccggcgcccgccgagttc
gtgcgcgcgctgcgcaagctgtgcgacgcgcacggcattctcctcatcgccgacgaagtg
cagacgggcttcgcgcgcacgggcaagctgttcgcgatggagcactacgacgtctcggcc
gacctgatgacgatcgcgaagagcctcgcgggcgggatgccgctgtcgggcgtcgtcggc
cgcgcggacgtgatggacgcggccgcgccgggcggcctgggcggcacatacgcgggcaat
ccgctcgccgtggccgccgcgcacgcggtgctcgacgtgatcgacgaggagaagctcgcc
gagcgcgcgaccgtgctcggcgacaagctgaaggcgaagctcgccgcgctgcgcgccgag
ctgccgcagatcgtcgacgtgcgcggcccgggcgcgatggtcgccgcggaattcgtcgat
ccgcacacgcgcgcgtccgatgccgcgttcacgaagcgcgtgcagacgctcgcgctcgag
cgcgggctgctgctgctcatctgcggcgtcgacgcgaacgtgatacgtttcctgtttcct
ctcaccatcgaggatgccgtgttcgacgaagcgctcggcattctcgagagcgtgctgagg
gaagcggtgggcgtgcccgcctga

DBGET integrated database retrieval system