KEGG   Burkholderia pseudomallei K96243: BPSS0491Help
Entry
BPSS0491          CDS       T00203                                 

Gene name
ahpF
Definition
(RefSeq) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bps  Burkholderia pseudomallei K96243
Brite
KEGG Orthology (KO) [BR:bps00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BPSS0491 (ahpF)
Enzymes [BR:bps01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BPSS0491 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 Glutaredoxin FAD_oxidored DAO NAD_binding_7 HI0933_like Thi4 AlaDh_PNT_C FAD_binding_3 NAD_binding_8 K_oxygenase FMO-like
Motif
Other DBs
NCBI-GeneID: 3095973
NCBI-ProteinID: YP_110512
UniProt: Q63N07
LinkDB All DBs
Position
2:complement(667638..669245)
Genome map
AA seq 535 aa AA seqDB search
MLDAHLKTQLKSYLERITRPVELVASLDAGDQSRELRALLDEIAALSPQIFVTERRDAAE
RAPSFSVGEPGKAAGIRFAGMPMGHEFTSLVLALLQTGGHPIKLDDATIEQIRALDGDYA
FETYISLTCQNCPEVVQALNVMALVNPRIRHVMIDGALFQDEVEARRIMAVPTIFLNGET
FGQGRSSVKEILAKLDGGASRRAAQALAEKPVFDMLIVGGGPAGAAAAIYAARKGISTGV
VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYDVDVIDVERADRLVPGRVHE
IRLASGAVLKAKTVVLATGARWREIGVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGLAAAVTLIEYGEQLHADDVLQRKLRSLANVTVITQARTTELTGDGAKL
NGLVYEDRRTGEAKRIALEGVFVQIGLVPNTEWLKETVELSRHGEIVVDTRGATSVPGVF
AAGDVTTVPYKQIVIAVGEGAKASLGAFDHLIRSEAHAVQAADIEASANAEAMAA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgcccatctcaagactcagttgaaatcgtacctcgaacggatcacgcgcccc
gtcgagctcgtcgcatcgctcgacgcaggcgaccagtcgcgcgagctgcgcgcgctgctc
gacgagatcgcggcgctgtcgccgcagatcttcgtgaccgaacgccgcgacgcggccgag
cgcgcgccgtcgttctcggtcggcgagccgggcaaggccgcgggcattcgcttcgccggt
atgccgatgggccacgaattcacgtcgctcgtgctcgcactgctgcagacgggcggccat
ccgatcaagctcgacgacgcgacgatcgagcagattcgcgcgctcgacggcgactacgca
ttcgagacgtatatctcgctcacctgccagaactgcccggaagtcgtacaggcgctcaac
gtgatggcgctcgtcaacccgcgcatccgccacgtgatgatcgacggcgcgctgttccag
gacgaagtcgaggcgcgccggatcatggccgtgccgacgatcttcctgaacggcgagacg
ttcggccagggccgcagcagcgtgaaggagatcctcgcgaaactcgacggcggcgcgagc
cggcgcgcggcgcaggcgctcgcggagaaacccgtgttcgacatgctgatcgtcggcggc
ggccccgcgggcgcggcggcggcgatctacgcggcgcgcaagggcatctcgacgggcgtc
gtcgccgagcgcttcggcggccaggtgctcgatacgatggcgatcgagaatttcgtgtcg
gtccaggaaaccgaggggccgaagttcgcgaccgcgctcgagcagcacgtgaagcaatac
gacgtcgacgtgatcgacgtagagcgcgccgaccggctcgtgccgggccgcgttcatgaa
attcgcctcgcgagcggcgcggtgctgaaggcgaagaccgtcgtgctcgcgacgggcgcg
cgctggcgcgagatcggcgtgcccggcgagcgcgagtatcgcaaccgcggcgtcgcgtac
tgcccgcattgcgacgggccgctcttcaagggcaagcgcgtcgcggtggtcggcggcggc
aactcgggtgtcgaggcggcgatcgatctcgccggccttgccgccgccgtgacgctgatc
gaatacggcgagcagttgcatgcggacgacgtgctgcaacgcaaactgcgcagcctcgcg
aacgtgacggtgatcacgcaggcacgcacgaccgagctcacgggcgacggcgcgaagctg
aacgggctcgtctacgaggacaggcgcacgggcgaggcgaagcgcatcgcgctcgaaggc
gtgttcgtgcagatcggcctcgtgccgaacaccgaatggctgaaggaaaccgtcgagctg
tcgaggcacggcgagatcgtcgtcgacacgcgcggcgcgacgtcggtgcccggcgtgttc
gccgccggcgacgtgacgacggtgccgtacaagcagatcgtgatcgcggtcggcgaaggc
gcgaaggcatcgctcggcgcattcgaccacctgattcgaagcgaggcgcatgccgtgcag
gcggcggatatcgaagcttcggcaaacgccgaggccatggccgcctga

DBGET integrated database retrieval system