KEGG   Burkholderia pseudomallei K96243: BPSS1888Help
Entry
BPSS1888          CDS       T00203                                 

Definition
(RefSeq) aromatic oxygenase
  KO
K16319  anthranilate 1,2-dioxygenase large subunit [EC:1.14.12.1]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
bps00627  Aminobenzoate degradation
bps01100  Metabolic pathways
bps01120  Microbial metabolism in diverse environments
Module
bps_M00637  Anthranilate degradation, anthranilate => catechol
Brite
KEGG Orthology (KO) [BR:bps00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BPSS1888
Enzymes [BR:bps01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.1  anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
     BPSS1888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske Ring_hydroxyl_A
Motif
Other DBs
NCBI-GeneID: 3094897
NCBI-ProteinID: YP_111894
UniProt: Q63J28
LinkDB All DBs
Position
2:complement(2563271..2564527)
Genome map
AA seq 418 aa AA seqDB search
MALIDRADSSDVRFPRDDGSRVPYKVFSSQAVYEREQERIFRGPTWNFVALEAEIPKPGD
FKSTFVGDTPVVVTRGEDGALAAWVNRCAHRGAQVCRKARGNASSHTCVYHQWSFDSRGD
LLGVPFRRGQKGMAGMPADFDPKNHGLRKLRVDSYKGLVFATFSDEVAPLPDYLGAQMRP
WIDRIFHKPIEYLGCTRQFSKSNWKLYFENVKDPYHASMLHLFHTTFNIFRVGMKARSIP
DATHGLHSIITMTKTQDDADTASAYKQQNIRSFDEGFSLEDDSILGLVSEYDEDTTNHIQ
PIFPQLVIQQIHNTLVARQLLPKGPKNFELIFHFFGYADDTPELRDLRIKQANLVGPAGY
ISMEDTEATELVQRGTVRDANAASVIEMSRGNPDQQDTAITESLIRRFWVGYQQLMGY
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtggcgctgatcgatcgcgccgattcgtccgacgtgcgctttccgcgcgacgacggctcg
cgcgtgccgtacaaggtgttcagctcgcaggcggtgtacgagcgcgagcaggagcggatc
ttccgcgggccgacgtggaatttcgtcgcgctcgaagcggaaattccgaagccgggcgat
ttcaagagcacgttcgtcggcgacacgcccgtcgtcgtcacgcgcggcgaggacggcgcg
ctcgccgcgtgggtgaaccgctgcgcgcatcgcggcgcgcaggtgtgccgcaaggcgcgc
ggcaacgcgagctcgcacacgtgcgtgtatcaccagtggagcttcgacagccggggcgac
ctgctcggcgtgccgttccggcgcggccagaagggcatggccgggatgccggccgatttc
gatccgaagaaccacgggctgcgcaagctgcgcgtcgacagctacaagggcctcgtgttc
gcgacgttcagcgacgaggtcgcgccgctgcccgattacctcggcgcgcagatgcggccg
tggatcgaccggatcttccacaagccgatcgagtatctcggctgcacgcggcagttctcg
aaatcgaactggaagctgtacttcgagaacgtgaaggacccgtatcacgcgagcatgctg
catctgttccatacgacgttcaatattttccgcgtcggcatgaaggcgcgctcgattccc
gatgcgacgcacgggctgcacagcatcatcacgatgacgaagacgcaagacgacgcggac
accgcgagcgcgtacaagcagcagaacatccgttcgttcgacgaaggtttctcgctcgag
gacgattcgatcctcggcctcgtgtccgagtacgacgaggacacgacgaaccacatccag
ccgatcttcccgcagctcgtgatccagcagatccacaacacgctcgtcgcacgccagttg
ctgccgaaggggccgaagaacttcgaattgatcttccacttcttcggctatgcggacgac
acgcccgagctgcgcgatttgcggatcaagcaggcgaacctcgtcgggcccgcgggctac
atctcgatggaggacaccgaggcgaccgagctcgtgcagcgcggcaccgtgcgcgacgca
aacgcggcgtcggtgatcgagatgtcgcgcggcaatccggaccagcaggacacggcgatc
accgagagcctgatccgcaggttctgggtcggctaccagcagttgatgggctattga

DBGET integrated database retrieval system