KEGG   Burkholderia pseudomallei NAU35A-3: BBU_1283Help
Entry
BBU_1283          CDS       T03476                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bpsa  Burkholderia pseudomallei NAU35A-3
Pathway
bpsa00020  Citrate cycle (TCA cycle)
bpsa00480  Glutathione metabolism
bpsa01100  Metabolic pathways
bpsa01110  Biosynthesis of secondary metabolites
bpsa01120  Microbial metabolism in diverse environments
bpsa01130  Biosynthesis of antibiotics
bpsa01200  Carbon metabolism
bpsa01210  2-Oxocarboxylic acid metabolism
bpsa01230  Biosynthesis of amino acids
Module
bpsa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpsa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bpsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BBU_1283 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BBU_1283 (icd)
Enzymes [BR:bpsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BBU_1283 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AIS87290
LinkDB All DBs
Structure
PDB: 

Position
1:complement(1544571..1545830)
Genome map
AA seq 419 aa AA seqDB search
MPYQHIKVPEGGDKITVNKDFSLNVSDQPIIPYIEGDGTGFDITPVMIKVVDAAVEKAYG
GKKKIHWMEIYAGEKATKVYGPDVWLPEETLQVLKEYVVSIKGPLTTPVGGGIRSLNVAL
RQELDLYVCLRPIQYFKGVPSPVREPEKTNMVIFRENSEDIYAGIEWAAESEQAKKVIKF
LQEEMGVKKIRFPQTSGIGIKPVSKEGTERLVRKAIQYAIDNDRKSVTLVHKGNIMKFTE
GAFRDAGYALAQKEFGAELIDGGPWMKFKNPKTGNEIVVKDSIADAFLQQILLRPAEYDV
IATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWTEAADVIISAMEKSIKQKRVTYDFARLMEGATQVSCSGFGQVLIENME
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcaaggttccggaaggcggtgacaagatcaccgtcaacaaggat
ttctcgctcaacgtttccgatcagccgatcatcccttacatcgagggcgacggcacgggc
ttcgacatcacgccggtgatgatcaaggtcgtcgacgcggcggtcgagaaggcgtacggc
ggcaagaagaagattcactggatggagatctacgccggcgagaaggcgacgaaggtctac
ggcccggacgtgtggctgccggaagagacgctgcaggtgctgaaggaatacgtcgtgtcg
atcaaggggccgctcacgaccccggtcggcggcggcatccgctcgctgaacgtcgcgctg
cgccaggagctcgacctgtacgtctgcctgcgcccgatccagtacttcaagggcgtgcct
tcgcccgtgcgcgagccggagaagaccaacatggtcatcttccgcgagaactcggaagac
atctacgccggcatcgaatgggcggccgaatccgagcaggcgaagaaggtcatcaagttc
ctgcaggaagagatgggcgtgaagaagatccgcttcccgcagacctcgggcatcggcatc
aagcccgtgtcgaaggaaggcaccgagcgcctcgtgcgcaaggcgatccagtacgcgatc
gacaacgaccgcaaatcggtcacgctcgtccacaagggcaacatcatgaagttcacggaa
ggcgcgttccgtgacgccggctatgcgctcgcgcagaaggaattcggcgccgagctgatc
gacggcggcccgtggatgaagttcaagaacccgaagacgggcaacgagatcgtggtcaag
gattcgatcgccgacgcgttcctgcagcagatcctgctgcgcccggccgaatacgacgtg
atcgcgacgctgaacctgaacggcgactacatctcggacgcgctcgccgcgcaagtcggc
ggcatcggcatcgcgccgggcgcgaacctgtcggattcggtcgcgatgttcgaagcgacg
cacggcacggcgccgaagtacgcgggcaaggattacgtgaacccgggttcggaaatcctg
tcggccgaaatgatgctgcgccacctcggctggaccgaagcggccgacgtgatcatttcc
gcgatggagaagtcgatcaagcagaagcgcgtcacgtacgacttcgcgcgcctgatggaa
ggcgcgacgcaagtgtcgtgctcgggcttcggtcaggtgctgatcgaaaacatggagtaa

DBGET integrated database retrieval system