KEGG   Burkholderia pseudomallei NAU35A-3: BBU_1957Help
Entry
BBU_1957          CDS       T03476                                 

Gene name
gatA
Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bpsa  Burkholderia pseudomallei NAU35A-3
Pathway
bpsa00970  Aminoacyl-tRNA biosynthesis
bpsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpsa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BBU_1957 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bpsa03029]
    BBU_1957 (gatA)
Enzymes [BR:bpsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BBU_1957 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BBU_1957 (gatA)
Mitochondrial biogenesis [BR:bpsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BBU_1957 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AIS86836
LinkDB All DBs
Position
1:complement(2330727..2332217)
Genome map
AA seq 496 aa AA seqDB search
MHAKSLTELRAALDAKECSAVELAQHYLKRIDAARDLNAFVHVDAELTLAQAKAADAALA
NGEAGPLAGLPIAHKDVFVTRGWRSTAGSKMLANYASPFDATVVARLSAAGMVTLGKTNM
DEFAMGSSNENSAFGPVKNPWDTSAVPGGSSGGSSAAVAARLAPAATGTDTGGSIRQPAS
FAGVTGIKPTYGCVSRYGMIAFASSLDQGGPMARSAADCALLLNAMAGFDERDSTSLERA
DEDYTRHLGKAWAAGGDAGKPLAGLRIGLPAEYFGAGLADDVRAAIDAALKTYEALGATL
VPVSLPKTELSIPVYYVIAPAEASSNLSRFDGVRYGHRAAEYRDLLDMYKKSRAEGFGPE
VKRRILVGTYVLSHGYYDAYYLQAQKIRRIIAQDFQEAFKSCDVIMGPASPTVAWDIGAK
GDDPVQMYLADIYTLSVSLAGLPGMSVPCGFGAGANAKRPVGLQIIGNYFDEARMLQVAD
AFQRATDWHVQEPAGV
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcaaaaagcctgaccgaactgcgcgccgcgctcgacgccaaggaatgctcggcc
gtcgagctggcgcagcactatctgaaacggatcgacgccgcgcgcgatctgaacgcgttc
gtccacgtcgacgccgagctcacgctcgcgcaggcgaaggccgccgacgccgcgctcgcc
aacggcgaggcggggccgctcgccggcctgccgatcgcgcacaaggacgtgttcgtcacg
cgcggctggcgctccaccgccggctcgaagatgctcgcgaactacgcgagcccgttcgac
gcgaccgtcgtcgcccgcctgtcggcggccggcatggtcacgctcggcaagaccaacatg
gacgagttcgcgatgggttcgtcgaacgagaactccgcgttcggcccggtgaagaacccg
tgggacacgagcgcggtgccgggcggcagctcgggcggcagctccgcggccgtcgccgcg
cgcctcgcgcccgccgcgacgggcaccgacacgggcggctcgatccgccagccggcgtcg
ttcgccggcgtgacgggcatcaagccgacctacgggtgcgtgtcgcgctacgggatgatc
gcgttcgcgtcgtcgctcgaccagggcggcccgatggcgcggagcgcggccgattgcgcg
ctcctgctgaacgcgatggcgggcttcgacgagcgcgattcgacgagcctcgagcgcgcc
gacgaagactacacgcgccacctcggcaaggcctgggcggccggcggcgacgcgggcaag
ccgctcgcgggcctgcgcatcggcctgccggccgaatatttcggcgcgggcctcgccgac
gacgtgcgcgcggcgatcgacgcggcgctgaagacctacgaggcgctcggcgcgacgctc
gtgccggtgtcgttgccgaagacggagctgtcgattcccgtctactatgtgatcgcgccc
gccgaggcgtcgtcgaacctgtcgcgcttcgacggcgtgcgctacggccaccgtgcggcc
gaataccgcgatctgctcgacatgtacaagaagtcgcgcgccgagggcttcgggcccgag
gtgaagcgccggattctcgtcggcacgtacgtgctgtcgcacggctactacgacgcctac
tacctgcaggcgcagaagatccgccggatcatcgcgcaggatttccaggaagcgttcaaa
tcctgcgacgtgatcatgggcccggcgtcgcccaccgtcgcgtgggacatcggcgcgaag
ggcgacgatcccgtccagatgtatctggcggatatctatacgctgtcggtgagcctcgcg
ggcttgcccggcatgagcgtgccgtgcggcttcggcgcgggcgcgaacgcgaagcgcccg
gtcgggctgcagatcatcggcaactatttcgacgaagcccggatgctgcaggtcgccgac
gcgttccagcgcgcgaccgactggcacgtacaagaaccggcaggagtgtga

DBGET integrated database retrieval system