KEGG   Burkholderia pseudomallei NAU35A-3: BBU_248Help
Entry
BBU_248           CDS       T03476                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bpsa  Burkholderia pseudomallei NAU35A-3
Pathway
bpsa00010  Glycolysis / Gluconeogenesis
bpsa00053  Ascorbate and aldarate metabolism
bpsa00071  Fatty acid degradation
bpsa00280  Valine, leucine and isoleucine degradation
bpsa00310  Lysine degradation
bpsa00330  Arginine and proline metabolism
bpsa00340  Histidine metabolism
bpsa00380  Tryptophan metabolism
bpsa00410  beta-Alanine metabolism
bpsa00561  Glycerolipid metabolism
bpsa00620  Pyruvate metabolism
bpsa00625  Chloroalkane and chloroalkene degradation
bpsa00903  Limonene and pinene degradation
bpsa01100  Metabolic pathways
bpsa01110  Biosynthesis of secondary metabolites
bpsa01120  Microbial metabolism in diverse environments
bpsa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBU_248
   00053 Ascorbate and aldarate metabolism
    BBU_248
   00620 Pyruvate metabolism
    BBU_248
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BBU_248
   00561 Glycerolipid metabolism
    BBU_248
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BBU_248
   00310 Lysine degradation
    BBU_248
   00330 Arginine and proline metabolism
    BBU_248
   00340 Histidine metabolism
    BBU_248
   00380 Tryptophan metabolism
    BBU_248
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BBU_248
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BBU_248
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BBU_248
Enzymes [BR:bpsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BBU_248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIS88677
LinkDB All DBs
Position
1:272474..273910
Genome map
AA seq 478 aa AA seqDB search
MKTCEQFYIGGAWRPSTGKGMIDVIDSGTEAVIGRVPEGTAEDAKAAVAAARAAFDGWAA
TPPAERARYLHKITENLKARSEELAQSITGEVGMPIKLSRAIQVGGPIYNWGAYAKLAET
FAFEEQVGNSLVVREPVGVVAAITPWNYPLNQITLKVAAALAAGCTVALKPSEVAPLNAF
ILAEAIHDAGLPAGVFNLVCGYGPVVGEALASDADVDMVSFTGSTRAGKRVAELAAAGVK
RVALELGGKSASVILDDADFAAAVKGTVSACYLNAGQTCSAHTRMLVPESRYEEARDLAK
AAAQAYVAGDPRDDATRLGALASSVQQKRVQDYIRRGIDEGAELVTGGLGMPEGITRGFF
VKPTVFGRVKPDATIAQEEIFGPVLSILTYRDEDDAVRIANDSPYGLGGAVWAGSDERAM
RVARRIRTGQVDINGGAWNMAAPFGGFKQSGIGRENGVYGLDEYLEYKSMQLRPHKRA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacctgcgaacagttctacatcggcggtgcatggcgcccgagcacgggcaagggc
atgatcgacgtgatcgactccggcaccgaggccgtgatcggccgcgtccccgaaggcacc
gccgaagacgcgaaagcggccgtcgcggccgcgcgcgcggcgttcgacggctgggccgcg
acgccgcccgccgagcgcgcccgctatctgcacaagatcaccgagaacctgaaggcgcgc
agcgaggagctcgcgcaatcgatcacgggcgaagtcggcatgccgatcaagctgtcgcgc
gcgatccaggtcggcgggccgatctacaactggggcgcgtatgcgaaactcgccgagacc
ttcgcgttcgaggagcaggtgggcaattcgctcgtcgtgcgcgagcctgtcggcgtcgtc
gcggcgatcacgccctggaactatccgctcaaccagatcacgctgaaggtcgcggccgcg
ctcgcggcgggctgcacggtcgcgctgaagccgtccgaggtcgcaccgctcaatgcgttc
atcctcgccgaggcgattcacgacgcggggctgcccgccggcgtgttcaatctcgtgtgc
ggctacgggcccgtcgtcggcgaggcgctcgcgagcgacgccgatgtcgacatggtgtcg
ttcaccggctcgacgcgcgcgggcaagcgcgtcgccgagctcgccgcggccggcgtgaag
cgcgtcgcgctcgaactgggcggcaaatcggcgtcggtgattctcgacgacgccgatttc
gcggccgcggtgaagggcacggtgtccgcgtgctatctgaacgccgggcagacgtgctcc
gcgcatacgcgcatgctcgtgcccgaatcgcgctacgaggaggcgcgcgacctcgcgaag
gccgccgcgcaagcctatgtcgcgggcgatccgcgcgacgacgcgacgcggctcggcgcg
ctcgcgtcgtcggtccagcaaaagcgcgtgcaggattacatccggcgcggcatcgacgaa
ggcgcggagctcgtcacgggcggcctcggcatgccggagggcatcacgcgcggcttcttc
gtgaagccgaccgtgttcggacgcgtgaagcccgacgcgacgatcgcgcaggaggagatc
ttcggcccggtgctgtcgattctcacgtatcgcgacgaggatgacgcggtgcgcatcgcg
aacgattcgccgtacgggctcggcggcgcggtgtgggcgggcagcgacgagcgcgcgatg
cgcgtcgcgcgccgcatccgcacggggcaggtcgatatcaacggcggggcatggaacatg
gccgcgccgttcggcggtttcaaacagtcgggcatcggccgcgagaacggcgtgtacggc
ctcgacgaatatctcgaatacaaatcgatgcaattgcgcccgcacaagcgcgcgtga

DBGET integrated database retrieval system