KEGG   Burkholderia pseudomallei NAU35A-3: BBU_2532Help
Entry
BBU_2532          CDS       T03476                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bpsa  Burkholderia pseudomallei NAU35A-3
Pathway
bpsa00473  D-Alanine metabolism
bpsa00550  Peptidoglycan biosynthesis
bpsa01100  Metabolic pathways
bpsa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bpsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BBU_2532 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BBU_2532 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BBU_2532 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bpsa01011]
    BBU_2532 (ddlB)
Enzymes [BR:bpsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BBU_2532 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:bpsa01011]
 Precursor biosynthesis
  Amino acid ligase
   BBU_2532 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATPgrasp_ST ATP-grasp TTL ATP-grasp_3 ATP-grasp_4 ATPgrasp_YheCD PPR
Motif
Other DBs
NCBI-ProteinID: AIS86655
LinkDB All DBs
Structure
PDB: 

Position
1:2952836..2953774
Genome map
AA seq 312 aa AA seqDB search
MSGIDPKRFGKVAVLLGGDSAEREVSLNSGRLVLQGLRDAGIDAHPFDPAQRPLAALKDE
GFVRAFNALHGGYGENGQIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGIPTPP
FETVMRGDDYAARAQAIVAKLGVPLFVKPASEGSSVAVEKVKSADALPAALEEAAKHDKI
VIVEKSIEGGGEYTACIAADLDLPLIRIVPAGEFYDYHAKYIANDTQYLIPCGLDAAKEA
EFKRIARRAFDVLGCTDWGRADFMLDAAGNPYFLEVNTAPGMTDHSLPPKAARAVGIGYS
ELVVKVLSLTLD
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggatcgatccgaaacgtttcggcaaggtggcggtgctgctcggcggggattcc
gccgagcgcgaggtatcgctgaactctggccggctggtgctgcagggcctgcgcgacgcg
ggcatcgacgcgcatccgttcgatccggcgcagcggccgctcgcggcgctcaaggacgaa
ggcttcgtgcgcgcgttcaacgcgctgcacggcggctacggcgagaacggccagatccag
ggcgcgctcgatttctacggcatccgctacacgggcagcggcgtgctcggctcggcgctc
gggctcgacaagttccgcacgaagctcgtctggcagcagacgggcattccgacgccgccg
ttcgagacggtgatgcgcggcgacgattatgcggcgcgcgcacaggccatcgtcgcgaag
ctcggcgtgccgcttttcgtgaagccggcgagcgagggctcgagcgtcgcggtcgagaag
gtgaaaagcgccgatgcgttgcccgccgcactggaagaagcggcgaagcacgacaagatc
gtgatcgtcgagaagagcatcgaaggcggcggcgaatacaccgcgtgcatcgccgcggac
ctcgatctgccgctcatcaggatcgtgcccgcgggcgagttctacgactatcacgcgaag
tacatcgcgaacgacacgcaatacctgattccgtgcggtctcgacgcggcaaaggaagcc
gagttcaagcgcatcgcgcgccgcgcgttcgacgtgctcggctgcacggactggggccgc
gcggatttcatgctcgacgccgcgggcaacccgtatttcctcgaagtgaacaccgcgccg
gggatgaccgatcactcgctgccgccgaaggcggcgcgcgcggtgggcatcggctattcg
gaactggtggtgaaagtgctgtcgctcacgctcgattga

DBGET integrated database retrieval system