KEGG   Burkholderia pseudomallei NAU35A-3: BBU_4123Help
Entry
BBU_4123          CDS       T03476                                 

Definition
(GenBank) ring hydroxylating beta subunit
  KO
K16320  anthranilate 1,2-dioxygenase small subunit [EC:1.14.12.1]
Organism
bpsa  Burkholderia pseudomallei NAU35A-3
Pathway
bpsa00627  Aminobenzoate degradation
bpsa01100  Metabolic pathways
bpsa01120  Microbial metabolism in diverse environments
Module
bpsa_M00637  Anthranilate degradation, anthranilate => catechol
Brite
KEGG Orthology (KO) [BR:bpsa00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BBU_4123
Enzymes [BR:bpsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.1  anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
     BBU_4123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ring_hydroxyl_B SnoaL_4
Motif
Other DBs
NCBI-ProteinID: AIS90631
LinkDB All DBs
Position
2:882039..882536
Genome map
AA seq 165 aa AA seqDB search
MTGITDSLTGDIRTWFELHMLQNRYIGHLDNDRLERWPELFTEDCLYEIVPKENADLGLP
IGIVYCTNRRMLRDRVVSLRHANIYEAHTYRHMTSGLTIVGGEGGEIETESSYVVVQTRS
DGESNVYQAGKYYDTVVRTAEGLRYRKKRVIYDTSRVQTLLATPI
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcatcaccgacagcctcaccggcgacattcgcacgtggttcgagctgcacatg
ctgcagaaccgctacatcgggcatctcgacaacgatcgcctcgaacgctggcccgagctg
ttcaccgaagactgcctgtacgagatcgtgccgaaggaaaacgcggacctggggctgccg
atcggcatcgtttactgcacgaaccggcggatgctgcgcgatcgcgtcgtgtcgctgcgc
cacgcgaacatctacgaagcgcacacgtaccggcacatgacgtccgggctcacgatcgtc
ggcggcgaaggcggcgagatcgagaccgagagcagctacgtcgtcgtgcagacgcgcagc
gacggcgaatcgaacgtctaccaggcgggcaagtactacgacacggtcgtgcgcacggcc
gaggggctgcgctaccggaagaagcgcgtgatttacgacacgtcgcgcgtgcagacgctg
ctcgcgacgccgatctga

DBGET integrated database retrieval system