KEGG   Burkholderia pseudomallei NAU35A-3: BBU_5556Help
Entry
BBU_5556          CDS       T03476                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bpsa  Burkholderia pseudomallei NAU35A-3
Brite
KEGG Orthology (KO) [BR:bpsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BBU_5556 (ahpF)
Enzymes [BR:bpsa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BBU_5556 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 Glutaredoxin FAD_oxidored AlaDh_PNT_C FAD_binding_3 Thi4 DAO HI0933_like NAD_binding_7 NAD_binding_8 K_oxygenase Ribosomal_S9 FMO-like
Motif
Other DBs
NCBI-ProteinID: AIS90753
LinkDB All DBs
Position
2:2746906..2748513
Genome map
AA seq 535 aa AA seqDB search
MLDAHLKTQLKSYLERITRPVELVASLDAGDQSRELRALLDEIAALSPQIFVTERRDAAE
RAPSFSVGEPGKAAGIRFAGMPMGHEFTSLVLALLQTGGHPIKLDDATIEQIRALDGDYA
FETYISLTCQNCPEVVQALNVMALVNPRIRHVMIDGALFQDEVEARRIMAVPTIFLNGET
FGQGRSSVKEILAKLDSGASRRAAQALAEKPVFDMLIVGGGPAGAAAAIYAARKGISTGV
VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYDVDVIDVERADRLVPGRVHE
IRLASGAVLKAKTVVLATGARWREIGVPGEREYRNRGVAYCPHCDGPLFKRKRVAVVGGG
NSGVEAAIDLAGLAAAVTLIEYGEQLRADDVLQRKLRSLANVTVITQARTTELTGDGAKL
NGLVYEDRRTGEAKRIALEGVFVQIGLVPNTEWLKGTVELSRHGEIVVDARGATSVPGVF
AAGDVTTVPYKQIVIAVGEGAKASLGAFDHLIRSEAHAVQAADIEASANAEAMAA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgcccatctcaagactcagttgaaatcgtacctcgaacggatcacgcgcccc
gtcgagctcgtcgcatcgctcgacgcaggcgaccagtcgcgcgagctgcgcgcgctgctc
gacgagatcgcggcgctgtcgccgcagatcttcgtgaccgaacgccgcgacgcggccgag
cgcgcgccgtcgttctcggtcggcgagccgggcaaggccgcgggcattcgcttcgccggt
atgccgatgggccacgaattcacgtcgctcgtgctcgcgctgctgcagacgggcggccat
ccgatcaagctcgacgacgcgacgatcgagcagattcgcgcgctcgacggcgactacgca
ttcgagacgtatatctcgctcacctgccagaactgcccggaagtcgtgcaggcgctcaac
gtgatggcgctcgtcaacccgcgcatccgccacgtgatgatcgacggcgcgctgttccag
gacgaagtcgaggcgcgccggatcatggccgtgccgacgatcttcctgaacggcgagacg
ttcggccagggccgcagcagcgtgaaggagatcctcgcgaaactcgacagcggcgcgagc
cggcgcgcggcgcaggcgctcgcggagaaacccgtgttcgacatgctgatcgtcggcggc
ggccccgcgggcgcggcggcggcgatctacgcggcgcgcaagggcatctcgacgggcgtc
gtcgccgagcgcttcggcggccaggtgctcgatacgatggcgatcgagaatttcgtgtcg
gtccaggaaaccgaggggccgaagttcgcgaccgcgctcgagcagcacgtgaagcaatac
gatgtcgacgtgatcgacgtagagcgcgccgaccggctcgtgccgggccgcgttcatgaa
attcgcctcgcgagcggcgcggtgctgaaggcgaagaccgtcgtgctcgcgacgggcgcg
cgctggcgcgagatcggcgtgcccggcgagcgcgagtatcgcaaccgcggcgtcgcgtac
tgcccgcattgcgacgggccgctcttcaagcgcaagcgcgtcgcggtggtcggcggcggc
aactcgggtgtcgaggcggcgatcgatctcgccggccttgccgccgccgtgacgctgatc
gaatacggcgagcagttgcgtgcggacgacgtgctgcaacgcaaactgcgcagcctcgcg
aacgtgacggtgatcacgcaggcacgcacgaccgagctcacgggcgacggcgcgaagctg
aacgggctcgtctacgaggacaggcgcacgggcgaggcgaagcgcatcgcgctcgaaggc
gtgttcgtgcagatcggcctcgtgccgaacaccgaatggctgaagggaaccgtcgagctg
tcgaggcacggcgagatcgtcgtcgacgcgcgcggcgcgacgtcggtgcccggcgtgttc
gccgccggcgacgtgacgacggtgccgtacaagcagatcgtgatcgcggtcggcgaaggc
gcgaaggcatcgctcggcgcattcgaccacctgattcgaagcgaggcgcatgccgtgcag
gcggcggatatcgaagcttcggcaaacgccgaggccatggccgcctga

DBGET integrated database retrieval system