KEGG   Burkholderia pseudomallei NAU35A-3: BBU_5963
Entry
BBU_5963          CDS       T03476                                 

Definition
(GenBank) type VI secretion lipofamily protein
  KO
K11906  type VI secretion system protein VasD
Organism
bpsa  Burkholderia pseudomallei NAU35A-3
Pathway
bpsa03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpsa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BBU_5963
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpsa02044]
    BBU_5963
Secretion system [BR:bpsa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BBU_5963
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: AIS91534
LinkDB
Position
2:3235813..3236316
AA seq 167 aa
MHPTTPVAAVALALACAACASGAAKQKEPLRLELAVRAAPTVNPDDRSRPAPIVVSVYEL
KTDGAFNAADFFTLQGPDKTVLADDLLARERFQLRPGEHRVIRRDADPAAGALGVVAAYR
DLPNSVWRAAYPLPPARDAAWYRFSSPKLKLTIELDTHAIRITEPGK
NT seq 504 nt   +upstreamnt  +downstreamnt
atgcatccgaccacccccgttgccgccgtcgcgctcgcgctcgcgtgcgccgcgtgcgcg
agcggcgcggccaagcagaaggagccgctgcggctcgagctcgccgtgcgcgccgcgccc
acggtcaatccggacgatcggagccggccggctccgatcgtcgtgagcgtctacgagctg
aagaccgacggcgcattcaacgccgccgatttcttcacgctgcagggcccggacaagacc
gtgctcgccgacgatctgctcgcgcgcgagcgttttcaactgcgccccggcgagcaccgc
gtgatccggcgcgacgccgatccggcggcgggcgcgctcggcgtcgtcgccgcgtaccgc
gatctgccgaactcggtgtggcgcgcggcatatccgctgccgcccgcgcgggacgccgca
tggtatcgcttctcgtcgccgaagctgaagctgaccatcgagctcgacacgcacgcgatc
aggatcaccgaacccggaaaatga

DBGET integrated database retrieval system