KEGG   Bifidobacterium pseudocatenulatum: BBPC_0119Help
Entry
BBPC_0119         CDS       T03932                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K23393  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Organism
bpsc  Bifidobacterium pseudocatenulatum
Pathway
bpsc00550  Peptidoglycan biosynthesis
bpsc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpsc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BBPC_0119
Enzymes [BR:bpsc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.13  lipid II isoglutaminyl synthase (glutamine-hydrolysing)
     BBPC_0119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1727 Mur_ligase_M Thymidylate_kin GP17
Motif
Other DBs
NCBI-ProteinID: BAR02797
UniProt: C0BR82
LinkDB All DBs
Position
158962..160488
Genome map
AA seq 508 aa AA seqDB search
MAWNSFATPLIGKAVRAASRLAHGGGSAFPGKIVEQIDPQFLARTLQQLPLGVVLVSGTN
GKTTTTRMVASMLESLGLKVFTNPTGSNFTRGVVSSLLAEVSLGGKLDADIAVLELDEAY
AVHFVKQVQPDYCLLLNVMRDQLDRFGEIDNTARLLSKAAEATTGTVVLNREDPRIARLA
DVTHTEDGVEVRYFGLDKSLRSFFPSDDDMCTTVDTESAADTEASVGIDLSESAESDENI
EIGDASAIAKTGEHAEKSENAESAEQLPADVTLLAVGDHRASFGIDGETYETGVKLEGVY
NLYNAAAALAAVRAVVADAQAMFLPFEENVTDELLRQVGISQRMIDFAHSTTQSMIDAAS
EVTPAFGRGEVIDVNGSPVELLLVKNPMGFRLSLASFAPEGCDTMIAINDEYADGRDMSW
LWDVDFSSLRGTGVSMVSGVRAWDMALRLEYDQVPVNSVNTELEEAVSTFVNANPGTPKH
IYCTYTAMLKTRAALGRIAEVADAGVGK
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggaactcattcgcaacgccgttgatcggcaaagccgtgcgagcggcctcccgc
ttggcacatggtggcggcagcgcgttccccggcaaaatcgtggaacagatcgacccacaa
ttcctcgcacgcacgctacagcagctgccgctcggcgtggtgctcgtatccggcacgaac
ggcaaaaccaccaccactcgcatggtggcaagcatgctggaatcgttgggattaaaagtg
ttcaccaacccgaccggatcgaacttcacccgtggcgtggtttcgtcgctgctggccgaa
gtctcgcttggcggcaaactggacgccgatatcgccgtgttggaactcgacgaagcgtat
gcggtgcatttcgtcaaacaagtgcaacctgactactgcctgctgctcaacgtgatgcgt
gaccagctcgaccgtttcggcgaaatcgacaataccgcccgcctgctgagcaaagctgcc
gaagcgaccaccggaaccgtggtgctcaatcgtgaggatccgcgcatcgcacggcttgca
gacgtcacgcatactgaagatggtgtggaagtgcgctatttcggacttgacaagtcgctg
cgcagcttcttcccttccgacgatgacatgtgcacgacggttgatacggaatcggcagct
gatactgaagcgtcagttggtattgacttgtccgaatctgcagaatcggacgaaaatatt
gagattggcgatgcttccgcaattgcgaaaactggggaacatgcagaaaaatcggaaaat
gcagaatctgcggaacagctaccggctgacgtgaccctgcttgccgtaggcgaccatcgt
gccagcttcggcatcgatggcgaaacgtacgaaaccggcgtgaaactggaaggtgtgtac
aacctgtacaacgcggcggccgcgctggctgccgtgcgagcggtcgtggccgacgcgcag
gcaatgttcctgccgttcgaagagaacgtaaccgacgaactgctgcgccaagtgggaatc
tcacagcgcatgatcgatttcgcgcactccaccacgcaatccatgatcgacgcggcatcc
gaagtcactccggcatttggacgcggcgaagtcatcgacgtgaacggttcaccggtggag
ctgctgctcgtcaaaaatcccatgggattccgtctgtcgctcgcatccttcgcccccgaa
ggctgcgacaccatgatcgccatcaacgacgaatacgccgacgggcgtgacatgagctgg
ctgtgggacgtggacttctcctcgctgcgaggcaccggtgtatctatggtttcaggcgtg
cgcgcatgggatatggcgttgcgtctcgaatatgatcaggtgccggtgaatagcgtcaac
acggaacttgaagaggccgtctcaacgttcgtgaacgcgaatccgggtacccccaagcat
atctactgcacatacacggcaatgctcaaaacgcgagccgcgctcggcagaatcgccgaa
gtcgccgacgctggcgtgggcaagtga

DBGET integrated database retrieval system