KEGG   Bifidobacterium pseudocatenulatum: BBPC_0333Help
Entry
BBPC_0333         CDS       T03932                                 

Definition
(GenBank) dehydrogenase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
bpsc  Bifidobacterium pseudocatenulatum
Pathway
bpsc00040  Pentose and glucuronate interconversions
bpsc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpsc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BBPC_0333
Enzymes [BR:bpsc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     BBPC_0333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: BAR03011
UniProt: C0BQI5
LinkDB All DBs
Position
431046..432086
Genome map
AA seq 346 aa AA seqDB search
MKAVVLEEQGVINVREVPDAPAPGLGELKIAPHTVGVCGSDLHYYTHGRVGKYVVEQPMI
LGHEASGTVVEVGPGVEGFKVGDRVAMEPGIPDMSSRASKLGMYNVDPAVRFFATPPIDG
CLCETVNHPAAFTYKLPDNVSFGEGALLEPLAVGMWSATKARIKPGDVCVVTGSGTVGML
TASCALAGGASKVLISDVSAIKLAIAAQIPGIIPVDLTKEDLVERVREETGGWGADVAFE
CSGSPKSYETFWKLIAPGGAAVIVGIPVNPVAIDITELQATEVRIENIFRYANVYQKAID
LVANGKLNLKPFITDTYAMEDAQAAFDRMAEGRPGDIKLQITVKND
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagtcgttctcgaagagcagggcgtcatcaatgtgcgtgaggtgccggacgcc
cccgcacctggtctaggcgagctgaagatcgcgccacataccgttggtgtgtgcggttcc
gacctgcattattacactcatggtcgcgtgggtaaatatgtggtggagcagccgatgatt
ctcggtcatgaggcttccggcacggtggttgaggtcggtcctggcgtcgaaggcttcaag
gtgggcgatcgtgtggccatggagcccggcattccggatatgagttcgcgtgccagcaaa
ctgggcatgtataacgtcgatcctgcggtgcgtttctttgccactccgccgattgatggc
tgcctgtgcgaaacggtgaaccatcctgcggcgttcacctacaagctgcccgacaatgtg
agcttcggtgagggtgcgctgcttgaaccgttggctgtgggcatgtggtccgccaccaag
gctcgtatcaagccgggcgatgtctgcgtggtcaccggatcaggcacggtcggcatgctg
accgcgtcgtgcgcgttggcgggtggcgcttccaaggtgctgatctccgatgtgtcggca
atcaaactggcgattgcggctcagattccaggtattattccggtggatctcaccaaagag
gatctggtggagcgcgtccgtgaggaaacggggggctggggtgctgatgtggctttcgag
tgctcgggctcgccgaagtcatacgagacattctggaagctgattgctcccggtggcgct
gccgttatcgttggcattccggtcaatccggtggccatcgacattacggaactgcaggct
accgaggtgcgcatcgaaaatatcttccgttatgccaatgtgtatcagaaggccattgac
ctcgtggctaacggtaaactgaatctgaagccattcatcaccgacacctatgcgatggag
gatgcccaggcggcgttcgatcgcatggctgaggggcgtcctggagacattaagctgcag
attaccgtgaaaaacgactga

DBGET integrated database retrieval system