KEGG   Bifidobacterium pseudocatenulatum: BBPC_1390Help
Entry
BBPC_1390         CDS       T03932                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
bpsc  Bifidobacterium pseudocatenulatum
Pathway
bpsc00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bpsc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BBPC_1390
Enzymes [BR:bpsc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BBPC_1390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Cellulase DUF4350 DUF4434
Motif
Other DBs
NCBI-ProteinID: BAR04068
UniProt: C0BSN0
LinkDB All DBs
Position
complement(1671348..1673474)
Genome map
AA seq 708 aa AA seqDB search
MGRYEADHILFGAAYYDEYLMMKGIDRVDEDMRMMKEAGLNVIRIAESTWSTCEPQPGAF
DFTYVDRALDAAQRVGIDVIVGTPTYAVPSWLVKIDPSVLAVTPNGEGKYGARQIMDIVN
ATYRFYGERVIRKLISHVADHPAVIGYQVDNETKYYDSVSNDMQRLFVKYLHEKFHGDLN
ELNHHFGLDYWSNRIDSWEDFPDVTATINESLGGEFDKFRRDQVRAFLQWQADIVREYAH
DDQFITHNFDFEWRGYSYGVQPAVDHFKAATAVDITGVDIYHPTEDDLTGKEIAFGGDMT
RSTKNGQNYLVLETEAQGQHGWVPFPGQLRLQAYSHLASGADMVEYWHWHSIHNSFETYW
KGLLSHDLEPNPTYCEAGVFGREIAKPEVGERLVHLKKHNKVAIMVSNESLTALDWFLIE
AGFPFGGTLKYNDVVRNVYDALFELNVECDFVPSDAPAERLAKYEMIVTPALYCASQETT
DRLRAFVENGGHLVSTMRSFVTDDEVTVWHDRAPHNLTDVFGMTYNQFTRPNGHVSVEFA
GALAETASTDAQSLIELLNADADTEVLASYGHYAWKDYAAVTRHAFGKGDAEWVATLLDA
DSIRAVMREAVEHAGVEGAGTALAGQVAVRQGVNARGENVTYLLNYSADEVTVASPIEGE
VVVAPVVIATDGSIDEVANAEVVLKEGAAVKQGDPLTIGRWNVAVIAG
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgttacgaggcagatcacattcttttcggtgccgcatattacgacgaatatctc
atgatgaaaggcatcgaccgtgtcgatgaagacatgaggatgatgaaggaagcgggactg
aacgttatccgtattgccgaatccacatggagcacctgcgaaccgcagccgggtgcgttc
gacttcacctatgtggatcgtgctctcgacgcggcacagcgtgtcggtatcgatgtcatc
gtcggcactccaacctacgcggtgccgagctggctcgtcaaaatcgatccgagcgtgctc
gcggtcactccgaacggcgaaggcaagtacggcgcccgccagatcatggacatcgtcaac
gccacctaccgtttctacggtgagcgcgtgatccgcaagctgatctcccacgttgccgac
catccggcggtgatcggctaccaagtcgataatgaaaccaagtactacgattccgtgtcc
aacgacatgcagcgtctgttcgtcaagtatctgcatgagaagttccacggcgatctgaac
gagctcaaccaccacttcggcctcgactactggtccaaccgcatcgactcctgggaggac
ttcccggacgtgactgccaccatcaacgagtccctgggcggcgaattcgacaagttccgc
cgcgatcaggtgcgcgccttcctgcagtggcaggccgacatcgtgcgcgaatacgcgcat
gacgaccagttcatcacccacaacttcgatttcgaatggcgcggatactcctacggcgtg
cagccggccgtcgaccacttcaaggccgcgaccgcagtggacatcaccggcgtggacatc
taccacccgaccgaagacgacctgaccggcaaggagatcgccttcggcggcgacatgacc
cgctccaccaagaacggccagaactacctggtgctcgaaaccgaggcccaaggccagcac
ggctgggtgccattccccggccagctgcgcctgcaggcctactcccacctcgcctccggc
gccgacatggtggaatactggcactggcactccatccataattcctttgaaacatattgg
aagggcctgctgagccacgacctcgaaccgaaccccacgtactgcgaagccggcgtattc
ggtcgcgagatcgccaaaccggaagtgggggagcggctcgtccacctgaagaagcacaac
aaagtagccatcatggtcagcaacgaatcgctgaccgcgctcgactggttcctcatcgaa
gccggcttcccattcggcggcaccctcaaatacaacgacgtggtgcgcaatgtctacgac
gcgctgttcgagctcaacgtcgaatgcgatttcgtgccgtccgatgctccggccgaacgt
ctcgccaaatacgagatgatcgtgaccccggcgctctactgcgcatctcaggaaactacg
gatcgcctgcgtgcgttcgttgaaaacggcggacacctcgtctccaccatgcgctccttc
gtgaccgacgacgaggtgaccgtatggcacgaccgcgcgccgcacaacctcaccgacgtg
ttcggcatgacgtacaaccagttcacccgcccaaacggccacgtttccgtggaattcgca
ggtgcgctcgccgaaaccgcgtccaccgatgctcagtcgctgatcgaactgttgaacgcc
gacgccgatactgaggtgctcgcatcctatggacactacgcttggaaggattacgccgca
gtcacccgtcacgcattcggcaaaggcgatgccgagtgggtcgccacactgcttgacgcc
gattccattcgtgcggttatgcgagaggccgtggagcatgccggcgtcgagggcgctgga
accgcgctcgcgggacaggtcgcggttcgccagggtgtgaatgcccgtggcgagaacgtg
acgtatctgctcaactattccgccgacgaagttactgttgcaagcccgattgagggtgaa
gtagtggtcgctccggtcgtcatcgccaccgacggcagtattgatgaggttgcaaatgct
gaagtcgtgctgaaggaaggtgcagccgtcaagcagggtgatccgttgacgatcggccgc
tggaatgttgcggtgatcgccggctga

DBGET integrated database retrieval system