KEGG   Bifidobacterium pseudocatenulatum: BBPC_1725Help
Entry
BBPC_1725         CDS       T03932                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bpsc  Bifidobacterium pseudocatenulatum
Pathway
bpsc00500  Starch and sucrose metabolism
bpsc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpsc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BBPC_1725
Enzymes [BR:bpsc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BBPC_1725
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     BBPC_1725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: BAR04403
UniProt: C0BVA6
LinkDB All DBs
Position
2136389..2137996
Genome map
AA seq 535 aa AA seqDB search
MISPSTHPCPQWLSNAIFYEIYPQSFADSNGDGIGDIPGITAKLGYITDLGCNAIWLNPC
FDSPFKDAGYDVRDYKKVAPRYGTNDDLAALFAAAHERGMHVILDLVPGHTSEEHEWFRH
SAEVDRNEYSDRYIWTDSWISGGDGLPFIGGETPRNGTYILNFFKCQPALNYGFAHPQRA
WQKPAFGPEAIATCDAMVDVMRFWLSLGADGFRVDMADSLVKQDDAGKPFTIRTWQYMFS
KIRPEFPEAAFVSEWGRPNESLEAGFDMDFYLDWRWDGIPNGYNMLLRNVDNPLSRDGDK
SYFNVDSGTPISDFLEQYEPQLREAEHLGGTFNFITCNHDTARVAPRLSEREIALAYCTL
FAMPGVPFIYYGDEIGMRYRDLPTKEGGYVRTGSRTPMQWQSLASLNASYATPAITGGNY
LPVDPSPDAPNVADSQSNKASLWYTVRRMLHLRGNCDPLQSRASFHPISRRRLFAFERST
DLERVIVAVNPSTNSERLQLPNGHYRKIFEIGETKVDFNTLTLGTQSFAILKATA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgatttccccttcgacacacccctgtccacaatggctctccaacgcgatcttctacgag
atctatccgcaatccttcgccgactccaatggcgacggcatcggagacattcccggcatc
accgcaaaactcggctacatcaccgaccttggctgcaacgcgatctggctgaacccgtgc
ttcgattcgcccttcaaagacgcgggctacgacgtgcgcgactacaagaaggtcgccccc
cgctacggcaccaacgacgatctggcggccctgttcgcagccgcccacgagcgcggcatg
catgtaatcctcgacctcgtgcccggccacaccagcgaggaacacgaatggttccgccac
agcgccgaggtggatcgcaacgagtattccgaccgttacatttggacggattcctggatt
tccggcggtgacggcctgccgttcatcggcggggaaacgccacgcaacggcacctacatt
ctgaacttcttcaaatgccagccggcactcaactacggtttcgcacatccccagcgcgca
tggcagaagcccgcgttcggcccggaggcgatcgccacctgcgatgcgatggtagacgtg
atgagattctggctttcgcttggcgcggacggcttccgcgttgacatggcagacagtctc
gtcaagcaggacgacgccggcaaaccgttcacgattcgcacttggcagtacatgttttcc
aagattcgtccggaatttccagaagccgcgttcgtgtcggaatggggacgcccgaacgaa
tcgctggaagccggtttcgatatggatttctatttggattggcgctgggacggcattccg
aacggctacaacatgctgttgcgcaacgtcgataatccgttgagcagggatggcgacaaa
agctatttcaacgtggattcgggcacgccgatcagtgattttctcgagcagtacgaaccg
cagctgcgcgaggcggaacacctcggaggcaccttcaatttcatcacctgcaaccacgac
accgcgcgcgtggcaccacgcctttccgagcgtgagatcgccctggcatactgcacgctg
ttcgctatgccgggcgtgcctttcatatattacggagacgagatcggcatgaggtaccgc
gacctgcccaccaaggagggcggctacgtgcgcaccggctcgcgcacgccgatgcaatgg
cagagcctcgcctcgctcaacgcgagttatgcgacgccggccatcaccggcgggaactat
cttccggtcgacccctcccctgacgcgcccaacgtcgccgactcccaatccaacaaagcc
tcactgtggtatacggtgcgccgcatgctgcatctgagggggaattgcgacccccttcaa
tcgagggcatccttccatccgatctcacgcagaaggctgttcgcattcgagcgttcgacc
gatctggaacgagtgatcgtggcggtcaatccgagcacaaacagcgaacgtttgcaatta
ccgaatggtcactatcgaaagattttcgaaatcggcgagaccaaggtcgatttcaacact
ttgaccctcggtacgcaaagctttgcaattctgaaggcgaccgcatga

DBGET integrated database retrieval system