KEGG   Burkholderia pseudomallei MSHR520: BBX_2966Help
Entry
BBX_2966          CDS       T03163                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bpsd  Burkholderia pseudomallei MSHR520
Pathway
bpsd00620  Pyruvate metabolism
bpsd00680  Methane metabolism
bpsd00710  Carbon fixation in photosynthetic organisms
bpsd01100  Metabolic pathways
bpsd01120  Microbial metabolism in diverse environments
bpsd01200  Carbon metabolism
Module
bpsd_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bpsd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBX_2966
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BBX_2966
   00680 Methane metabolism
    BBX_2966
Enzymes [BR:bpsd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BBX_2966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 FAD-oxidase_C
Motif
Other DBs
NCBI-ProteinID: AHK64012
LinkDB All DBs
Position
1:3362101..3365085
Genome map
AA seq 994 aa AA seqDB search
MKSSGSARATRRNAVSSSSAPAHAEPPARRAAKPARKLDGAAARPLAPTNAASAKPQGRT
REDKDRPLFEDIRYLGRLLGDVVREQEGDAVFDVVETIRQTAVKFRREDDKAAAQTLEKM
LRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSAAQAGTVAYALDKLKQA
GDASSKTIKQFFEGALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQPLTARELAHNE
ALLRARVTTLWQTRMLRDARLTVADEIENALSYYRATFLDELPALYADIEEALAEHGLRA
RVPAFFQMGSWIGGDRDGNPNVTAATLDEAISRQAAVIFEHYLEQVHKLGAELSVSNLLV
GASDALKALAAASPDQSPHRVDEPYRRALIGVYTRLAASARVRLGEGTVPVRSAGRGAAP
VRATPYADAEEFAADLRVLTDSLALHHGESLATPRLAPLMRAAEVFGFHLASIDLRQSSD
IHEAVVAELLARGGVEADYAALPEADKLRVLLAALADPRPLRSPYLDYSDLAKSELGVLE
RAHAIRAQFGARAVRNYIISHTETVSDLVEVLLLQKETGLFEGTLGTPHANARNGLMVIP
LFETIADLRNASDIMRAFFALPGVGELLAHQGHEQEVMLGYSDSNKDGGFLTSNWELYRA
ELALVDLFDERGIKLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQGEVIASK
FANPEIGRRNLETVVAATLEATLAPHSNAPKQLPAFEAAMQTLSDAAMASYRALVYETPG
FTDYFFSSTPITEIAELNIGSRPASRKLQDPKNRKIEDLRAIPWGFSWGQCRLLLTGWYG
FGSAVAAYLDGAPDAAERGKRVALLKKMNKTWPFFANLLSNMDMVLAKTDLAVASRYAQL
VADKKLRKHVFERIVAEWHRTADALAEITGAHARLAANPLLARSIKNRFPYLDPLNHLQV
ELIKRHRAGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcttccggatcggcgcgcgcgacgcgccgcaatgctgtctcgtcctcttccgcc
ccggcgcacgccgagccccccgcccgccgcgccgcgaaacccgcacgcaagctcgacggc
gccgccgcgcgcccgctcgcgccgacgaacgccgcatccgcgaaaccgcaaggccgcacg
cgcgaagacaaggaccgcccgctcttcgaggacattcgctatctcggccgcctgctcggc
gacgtcgttcgcgaacaggaaggcgacgccgtgttcgacgtcgtcgagacgattcgccag
accgcggtcaagttccgccgcgaggacgacaaggctgccgcgcagacgctcgagaaaatg
ctgcgcaagctcacgcccgagcagacggtgagcgtcgtgcgcgcgttcagctatttctcg
cacctcgcgaacatcgccgaggaccgccatcacaaccgccgccgccgcatccacgcgctc
gcgggctccgcggcgcaggcgggcaccgtcgcgtacgcgctcgacaagctcaagcaggcg
ggcgacgcgtcgtcgaagacgatcaagcagttcttcgaaggcgcgctgatcgtgcccgtg
ctcaccgcgcacccgaccgaggtgcagcgcaagagcattctcgacgcgcagcacgacatc
gcgcggctgctcgccgagcgcgaccagccgctgaccgcgcgcgagctcgcgcacaacgag
gcgctgctgcgcgcgcgcgtgacgacgctctggcagacccggatgctgcgcgacgcgcgc
ctgaccgtcgccgacgagatcgagaacgcgctgtcgtactaccgcgcgacgttcctcgac
gagttgcccgcgctctacgcggacatcgaggaggcgctcgccgagcacggcctgcgcgcg
cgcgtgccggcgttcttccaaatgggcagttggatcggcggcgaccgcgacggcaacccg
aacgtcaccgccgcgacgctcgacgaggcgatcagccgccaggcggcggtgatcttcgag
cattacctcgaacaggtgcacaagctcggcgcggagctgtccgtgtcgaacctgctcgtc
ggcgcgagcgacgcgctcaaggcgctcgccgccgcgtcgccggaccagtcgccgcatcgc
gtcgacgagccgtaccgccgcgcgctgatcggcgtctacacgcggctcgcggccagcgcg
cgcgtgcggctcggcgagggcacggtgcccgtgcgcagcgcgggccgcggcgccgcgccc
gtgcgcgcgacgccgtacgcggacgcggaggagttcgccgccgatctgcgcgtgctgacc
gattcgctcgcgctgcatcacggcgaatcgctcgcgacgccgcgcctcgcgccgctcatg
cgcgcggccgaggtgttcggcttccatctcgcgagcatcgatttgcggcagagctcggac
atccatgaagcggtggtcgccgaactgctcgcgcgcggcggcgtcgaggccgactacgcg
gcgctgcccgaagcggacaagctgcgcgtgctgctcgcggcgctcgcggacccgcggccg
ctgcgctcgccgtatctcgactactcggacctcgcgaagagcgagctcggcgtgctcgag
cgcgcgcacgcgatccgcgcgcagttcggcgcgcgcgcggtgcgcaactacatcatttcg
cataccgagacagtgagcgatctcgtcgaggtgctgctgctgcagaaggaaacgggcctc
ttcgagggcacgctcggcacgccgcacgcgaacgcgcgcaacggcctgatggtgattccg
ctcttcgagacgatcgccgacctgcgcaacgcgtccgacatcatgcgcgcgttcttcgcg
ctgccgggcgtgggcgagctgctcgcgcaccagggccacgagcaggaagtgatgctcggc
tattcggacagcaacaaggacggcggcttcctcacgtcgaactgggagctctatcgcgcg
gaactggcgctcgtcgatctgttcgacgagcgcgggatcaagctgcgcctgttccacggc
cgcggcggcacggtgggacgcggcggcggcccgacctatcaggcgatcctgtcgcagcca
cccggcacggtaaacggccagatccggctcaccgagcagggcgaggtgatcgcgagcaag
ttcgcgaacccggagatcggccggcgcaatctggagacggtcgtcgccgcgacgctcgag
gcgacgctcgcgccgcacagcaacgcgccgaagcagttgcccgcgttcgaggcggcgatg
cagacgctgtcggacgcggcgatggcgtcgtaccgcgcgctcgtctacgagacgcccggc
ttcaccgactacttcttctcgtcgacgccgatcaccgagatcgccgagctgaacatcggc
agccggcccgcgtcgcgcaagctgcaggatccgaagaaccgcaagatcgaggacctgcgc
gcgattccgtggggcttctcatggggccagtgccggctgctgctcaccggctggtacggc
ttcggcagcgcggtcgccgcgtatctcgacggcgcgccggacgcggccgagcgcggcaag
cgcgtcgcgctgctgaagaaaatgaacaagacctggccgttcttcgcgaacctgctgtcg
aacatggacatggtgctcgcgaagaccgatctcgcggttgcgtcgcgctacgcgcaactc
gtcgccgacaagaagctgcgcaagcacgtgttcgagcggatcgtcgccgaatggcatcgc
acggcggatgcgctcgccgagatcaccggcgcgcacgcgcggctcgccgcgaatccgctt
ctcgcgcgctcgatcaagaaccgcttcccgtacctcgatccgctgaatcacctgcaagtc
gagctgatcaagcggcaccgcgcgggcgacacgaacgcgcggctgcggcgcgggatccat
ctgacgatcaacgggatcgcggccggcctgcgcaatacgggctga

DBGET integrated database retrieval system