KEGG   Burkholderia pseudomallei MSHR520: BBX_5233
Entry
BBX_5233          CDS       T03163                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
bpsd  Burkholderia pseudomallei MSHR520
Brite
KEGG Orthology (KO) [BR:bpsd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpsd02044]
    BBX_5233
Secretion system [BR:bpsd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BBX_5233
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: AHK69323
LinkDB
Position
2:complement(2100246..2101745)
AA seq 499 aa
MKKQQAQTAAAGVQPQADSDFAQLLAQEFKPKTEQAREAVEYAVRTLAEQALAQSATISD
DAYKSIAAIIAQIDHKLSEQINLILHHADFQKLESAWRGLHHLVSNTETDERLKIRFMDI
SKEELRRTMRRYKGQSWDQSPLFKQIYEEEYGQLGGEPYGCLVADYYFDHTPPDVDLLGS
ISKVAASAHTPFLSGASPSVLQMESWQELANPRDLTKIFTQNLEYASWNALRNMDDARYI
GLAMPRFLSRLPYGVLTNPVDEFDFEEDTNGADHRRYAWTNAAYAMGVNINRSFRLYGWC
SLIRGVESGGTVENLPCHTFPTDDGGIDIKCPTEIAISDRREAELSKNGFIPLVHRKNTD
HATFIGAQSLHKPAEYDDSDATANANLSARLPYLFACSRFAHYLKCIVRDKVGAFKERED
MQRWLNEWIMNYVDADPANSSQDTKARRPLAAAEVVVEQAQGNPGYYQAKFFLRPHFQLE
GLTVSLRLVAKLPSIKEAA
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgaagaaacagcaagcccagacggccgccgccggcgtccagccgcaagcggattcggat
ttcgcgcagttgctcgcgcaggagttcaagccgaagacggagcaggcgcgcgaagcggtc
gaatacgcggtgcgcacgctcgccgagcaggcgctcgcgcaatcggcgacgatcagcgac
gatgcatacaagagcatcgccgcgatcatcgcgcagatcgaccataagctatccgaacag
atcaacctgatcctccatcacgcggatttccagaagctcgaatcggcgtggcgcgggctg
catcacctggtgtcgaacaccgagaccgacgagcgcctgaagatccgctttatggacatc
tcgaaggaagagctgcgccgcacgatgcggcgctacaaggggcaatcgtgggaccagagc
ccgctcttcaagcagatctacgaggaggagtacgggcagctcggcggcgagccgtacggc
tgcctcgtcgccgattactacttcgaccacacgccgcccgacgtcgacctgctcggctcg
atctcgaaggtggccgcgtccgcgcacacgccgttcctctccggcgcgtcgccttcggtg
ctgcagatggaatcgtggcaggagctcgcgaacccgcgcgacctgacgaagatcttcacg
caaaacctcgaatacgcgtcatggaacgcgctgcgcaacatggacgacgcgcgctacatc
ggcctcgcgatgccgcgcttcctgtcgcgcctgccgtacggcgtgctgacgaatcccgtc
gacgagttcgacttcgaggaagacacgaacggcgccgaccatcgccgctacgcgtggacg
aacgccgcctacgcgatgggcgtgaacatcaaccggtcgttccggctctacggctggtgc
tcgctcattcgcggcgtcgaatcgggcggcaccgtcgagaacctgccgtgccatacgttc
ccgaccgacgacggcggcatcgacatcaaatgcccaaccgagatcgcgatctcggaccgg
cgcgaggcggagctgtcgaagaacggcttcattccgctcgtgcaccgcaagaacaccgat
cacgcgacgttcatcggcgcgcaatcgctgcacaagccggccgaatacgacgattccgac
gcgacggccaacgcgaatctgtcggcgcgcctgccgtatctgttcgcatgctcgcgcttc
gcgcactacctgaagtgcatcgtgcgcgacaaggtgggcgccttcaaggagcgcgaggac
atgcagcgctggctgaacgaatggatcatgaactacgtcgacgcggacccggcgaactcg
tcgcaggacacgaaggcgcgccggccgctcgcggccgccgaggtggtcgtcgagcaggcg
caaggcaaccccggctactaccaggcgaagttcttcctgcggccgcatttccagctcgag
ggcctgaccgtgtcgctgcggctcgtcgcgaagctgccgtcgatcaaggaagccgcctga

DBGET integrated database retrieval system