KEGG   Burkholderia pseudomallei MSHR520: BBX_795Help
Entry
BBX_795           CDS       T03163                                 

Definition
(GenBank) D-alanine--D-alanine ligase family protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bpsd  Burkholderia pseudomallei MSHR520
Pathway
bpsd00473  D-Alanine metabolism
bpsd00550  Peptidoglycan biosynthesis
bpsd01100  Metabolic pathways
bpsd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bpsd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BBX_795
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BBX_795
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BBX_795
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bpsd01011]
    BBX_795
Enzymes [BR:bpsd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BBX_795
Peptidoglycan biosynthesis and degradation proteins [BR:bpsd01011]
 Precursor biosynthesis
  Amino acid ligase
   BBX_795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATPgrasp_ST ATP-grasp TTL ATP-grasp_3 ATP-grasp_4 ATPgrasp_Ter ATPgrasp_YheCD PPR
Motif
Other DBs
NCBI-ProteinID: AHK66680
LinkDB All DBs
Structure
PDB: 

Position
1:853490..854428
Genome map
AA seq 312 aa AA seqDB search
MSGIDPKRFGKVAVLLGGDSAEREVSLNSGRLVLQGLRDAGIDAHPFDPAQRPLAALKDE
GFVRAFNALHGGYGENGQIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGIPTPP
FETVMRGDDYAARAQDIVAKLGVPLFVKPASEGSSVAVEKVKSADALPAALEEAAKHDKI
VIVEKSIEGGGEYTACIAADLDLPLIRIVPAGEFYDYHAKYIANDTQYLIPCGLDAAKEA
EFKRIARRAFDVLGCTDWGRADFMLDAAGNPYFLEVNTAPGMTDHSLPPKAARAVGIGYS
ELVVKVLSLTLD
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggatcgatccgaaacgtttcggcaaggtggcggtgctgctcggcggggattcc
gccgagcgcgaggtatcgctgaactctggccggctggtgctgcagggcctgcgcgacgcg
ggcatcgacgcgcatccgttcgatccggcgcagcggccgctcgcggcgctcaaggacgaa
ggcttcgtgcgcgcgttcaacgcgctgcacggcggctacggcgagaacggccagatccag
ggcgcgctcgatttctacggcatccgctacacgggcagcggcgtgctcggctcggcgctc
gggctcgacaagttccgcacgaagctcgtctggcagcagacgggcattccgacgccgccg
ttcgagacggtgatgcgcggcgacgattatgcggcgcgcgcgcaggacatcgtcgcgaag
ctcggcgtgccgcttttcgtgaagccggcgagcgagggctcgagcgtcgcggtcgagaag
gtgaaaagcgccgatgcgttgcccgccgcactggaagaagcggcgaagcacgacaagatc
gtgatcgtcgagaagagcatcgaaggcggcggcgaatacaccgcgtgcatcgccgcggat
ctcgatctgccgctcatcaggatcgtgcccgcgggcgagttctacgactatcacgcgaag
tacatcgcgaacgacacgcaatacctgattccgtgcggcctcgacgcggcaaaggaagcc
gagttcaagcgcatcgcgcgccgcgcgttcgacgtgctcggctgcacggactggggccgc
gcggatttcatgctcgacgccgcgggcaacccgtatttcctcgaagtgaacaccgcgccg
gggatgaccgatcactcgctgccgccgaaggcggcgcgcgcggtgggcatcggctattcg
gagctggtggtgaaagtgctgtcgctcacgctcgattga

DBGET integrated database retrieval system