KEGG   Burkholderia pseudomallei MSHR305: BDL_2608
Entry
BDL_2608          CDS       T02756                                 

Definition
(GenBank) carbon-nitrogen hydrolase family protein
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
bpse  Burkholderia pseudomallei MSHR305
Brite
KEGG Orthology (KO) [BR:bpse00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BDL_2608
Enzymes [BR:bpse01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     BDL_2608
SSDB
Motif
Pfam: CN_hydrolase
Other DBs
NCBI-ProteinID: AGR73602
LinkDB
Position
2:complement(3016044..3016820)
AA seq 258 aa
MVSTPDRERNLAEAGRLIADAAASGARLVLLPEYFCFMGHQDTDKLALAEAYRDGPIQRF
LAERAKAHGIWVIGGTLPLKAPEPSRVLNTTLVFDPQGREAARYDKIHLFNFEKGDESFD
EARTIRPGDAVRTFDAPFGRVGLSVCYDLRFPELYRRMGDCAMIVVPSAFTYTTGRAHWE
TLLRARAVENQCYVLAAAQGGKHENGRRTWGRSMLVDPWGEIVAVRDEGAGVVAGEIDPA
RIADVRQSLPAWRHRVLA
NT seq 777 nt   +upstreamnt  +downstreamnt
atggtcagcacgcccgatcgcgagcgcaatctcgccgaagccggccggctgatcgccgat
gcggcggcctcgggcgcacggctcgtgctgctgcccgaatatttctgcttcatgggccac
caggacaccgacaagctcgcgctcgcggaagcgtaccgtgacggcccgatccagcgcttt
ctcgccgagcgcgcgaaggcgcacggcatctgggtgatcggcggcacgctgccgctgaag
gcgcccgagccgtcgcgcgtgctgaacacgacgctcgtgttcgatccgcaaggccgcgag
gccgcccgctacgacaagatccacctgttcaacttcgagaagggcgacgagtcgttcgac
gaggcgcgcacgatccgcccgggcgacgcggtgcgcacgttcgacgcgccgttcggccgg
gtcgggctgtcggtctgctacgatctgcgctttccggagctgtaccggcgaatgggcgac
tgcgcgatgatcgtcgtgccgtcggcgttcacgtacacgacggggcgcgcgcactgggag
acgctgttgcgcgcccgcgcggtcgagaaccagtgctacgtgctcgccgccgcgcaaggc
ggcaagcacgagaacggccgccgcacgtgggggcgcagcatgctcgtcgatccgtggggc
gagatcgtcgcggtgcgcgacgaaggcgcgggcgtcgtcgcgggcgagatcgatcccgcg
cggatcgccgacgtgcggcagagcctgcccgcgtggcggcatcgcgtgctcgcgtga

DBGET integrated database retrieval system