KEGG   Burkholderia pseudomallei MSHR305: BDL_3369Help
Entry
BDL_3369          CDS       T02756                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bpse  Burkholderia pseudomallei MSHR305
Pathway
bpse00473  D-Alanine metabolism
bpse01100  Metabolic pathways
bpse01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bpse00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BDL_3369 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BDL_3369 (alr)
Enzymes [BR:bpse01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BDL_3369 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bpse01011]
 Precursor biosynthesis
  Racemase
   BDL_3369 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AGR72666
LinkDB All DBs
Position
2:3869656..3870726
Genome map
AA seq 356 aa AA seqDB search
MPRPISATIHTAALANNLSVVRRHAAQSKVWAIVKANAYGHGLARVFPGLRGTDGFGLLD
LDEAVKLRELGWAGPILLLEGFFRSTDIDVIDRYSLTTAVHNDEQMRMLETARLSKPVNV
QLKMNSGMNRLGYTPEKYRAAWERARACPGIGQITLMTHFSDADGERGVAEQMATFERGA
QGIAGARSFANSAAVLWHPSAHFDWVRPGIMLYGASPSGRAADIADRGLKPTMTLASELI
AVQTLAKGQAVGYGSMFVAEDTMRIGVVACGYADGYPRIAPEGTPVVVDGVRTRIVGRVS
MDMLTVDLTPVPQAGVGARVELWGETLPIDDVAARCMTVGYELMCAVAPRVPVRAE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcccgatttccgccacgatccacaccgcagctctcgcgaacaacctctccgtc
gtgcgccgccacgccgcccagtcgaaggtctgggcgatcgtcaaggcgaacgcgtacggg
cacggtctcgcgcgcgtctttcccgggctgcgcggcaccgacggcttcggcctgctcgac
ctcgacgaggccgtgaagctgcgcgaactgggctgggcggggccgatcctgctgctcgag
ggcttcttccggtcgaccgacatcgacgtgatcgaccgctacagcctgacgaccgcggtg
cacaacgacgagcagatgcgcatgctcgagaccgcgcggctgtcgaagcccgtgaacgtc
cagctgaagatgaacagcggcatgaaccggctcggctacacgcccgagaagtaccgggcc
gcctgggagcgcgcgcgcgcatgcccgggcatcggccagatcacgttgatgacccatttt
tcggacgccgacggcgaacgcggcgtggccgagcagatggcgacgttcgagcgcggcgcg
caaggcatcgccggcgcgcgcagcttcgcgaactcggccgccgtgctctggcacccgtcg
gcgcacttcgactgggtgcggcccggcatcatgctgtacggcgcgtcgccgtccggccgt
gcggcggacatcgccgaccggggcctgaagccgacgatgacgctcgcctccgagctgatc
gccgtgcagacgctcgcgaaagggcaggcggtcggctacggatcgatgttcgtcgccgag
gacacgatgcgcatcggcgtcgtcgcgtgcggctatgcggacggctatccgcggatcgcg
cccgagggcacgcccgtcgtcgtcgacggcgtgcgcacgcggatcgtcggccgcgtgtcg
atggacatgctgaccgtcgatctcacgcccgtgccgcaggcgggcgtcggcgcgcgcgtc
gagctgtggggcgagacgctgccgatcgacgacgtcgccgcgcgctgcatgacggtcggc
tacgagctgatgtgcgcggtcgcgccgcgcgtgcccgtgcgtgccgagtaa

DBGET integrated database retrieval system