KEGG   Burkholderia pseudomallei MSHR305: BDL_3733Help
Entry
BDL_3733          CDS       T02756                                 

Definition
(GenBank) 2-aminoethylphosphonate aminotransferase family protein
  KO
K03430  2-aminoethylphosphonate-pyruvate transaminase [EC:2.6.1.37]
Organism
bpse  Burkholderia pseudomallei MSHR305
Pathway
bpse00440  Phosphonate and phosphinate metabolism
bpse01100  Metabolic pathways
bpse01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpse00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BDL_3733
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bpse01007]
    BDL_3733
Enzymes [BR:bpse01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.37  2-aminoethylphosphonate---pyruvate transaminase
     BDL_3733
Amino acid related enzymes [BR:bpse01007]
 Aminotransferase (transaminase)
  Class V
   BDL_3733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP Aminotran_1_2 Beta_elim_lyase Phage_TAC_11 SHMT
Motif
Other DBs
NCBI-ProteinID: AGR68962
LinkDB All DBs
Position
1:complement(255768..256835)
Genome map
AA seq 355 aa AA seqDB search
MLLLNPGPVTLTERVRQSLLQPDLCHRESEFFDLQDEARARLVAAYALDPAEWSAVLMTG
SGTAAVESMIAALVPENGKLLVIENGVYGERITQIATQYRIAHDVLKHDWMQAPDLACVA
EKLDADRAITHVAVIHHETTTGRLNDLDALAAVCRARGVRMLVDGVSSFGAEAIDFAGGD
IDALAATANKCLHGVPGAAFVIVRRRALASAASRTYYLDLGRLAKLQDARNTPFTPSVHA
YYALVEALREFDEAGGWRARHARYAALAEQVRAGLAARGMPLVLPDGESSVVLRAYRLPA
GVAYEQLHDGLKARGFVIYAGQGGLSSALFRVSTMGAIEPADVERLLDGFTALAR
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgctgttgctgaatcccggtcccgtgacgctgacggagcgtgtgcgccaaagcctgctg
cagccggacctgtgccaccgcgaaagcgaattcttcgatctgcaggacgaggcgcgcgcg
cggctcgtcgccgcgtacgcgctcgatccggccgaatggagcgcggtgctgatgacgggc
tccggcacggccgcggtcgagagcatgatcgccgcgctcgtgccggaaaacggcaagctg
ctcgtgatcgagaacggcgtgtacggcgagcggatcacgcagatcgcgacgcagtaccgg
atcgcgcacgacgtgctgaaacacgactggatgcaggcgccggatctcgcgtgcgtcgcc
gagaagctcgacgcggatcgcgcgatcacgcatgtcgcggtgatccatcacgaaacgacc
acgggccgcctgaacgacctcgacgcgctcgccgccgtgtgccgcgcgcgcggcgtgcgc
atgctcgtcgacggcgtgagcagcttcggcgcggaggcgatcgatttcgcgggcggcgac
atcgacgcgctcgccgcgaccgcgaacaaatgcctgcacggcgtgccgggcgcggcgttc
gtgatcgtgcgccgccgcgcgctcgcgagtgccgcgagccgcacctactacctcgatctc
ggccggctcgcgaagctgcaggacgcgcgcaacacgccgttcacgccgtcggtgcacgca
tactacgcgctcgtcgaggcgctgcgcgagttcgacgaggcgggcggctggcgcgcgcgc
cacgcgcgctacgcggcgctcgccgaacaggtgcgcgccggcctcgccgcgcgcggcatg
ccgctcgtgctgccggacggcgaatcgtcggtcgtgctgcgcgcgtaccggctgcccgcc
ggcgtcgcgtacgagcaactgcacgacggcctgaaagcgcgcggcttcgtgatctacgcg
ggccagggcgggctgtcgagcgcgttgttccgcgtgtcgacgatgggcgcgatcgagcct
gcggacgtcgagcgcctcctcgacggattcaccgcgctcgcgcgctga

DBGET integrated database retrieval system