KEGG   Burkholderia pseudomallei MSHR305: BDL_5071Help
Entry
BDL_5071          CDS       T02756                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur family protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bpse  Burkholderia pseudomallei MSHR305
Pathway
bpse00020  Citrate cycle (TCA cycle)
bpse00190  Oxidative phosphorylation
bpse00650  Butanoate metabolism
bpse01100  Metabolic pathways
bpse01110  Biosynthesis of secondary metabolites
bpse01120  Microbial metabolism in diverse environments
bpse01130  Biosynthesis of antibiotics
bpse01200  Carbon metabolism
Module
bpse_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpse_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bpse_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bpse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BDL_5071
   00650 Butanoate metabolism
    BDL_5071
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BDL_5071
Enzymes [BR:bpse01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BDL_5071
    1.3.5.4  fumarate reductase (quinol)
     BDL_5071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4_7 Fer4_18 Fer4_4 Fer4
Motif
Other DBs
NCBI-ProteinID: AGR69438
LinkDB All DBs
Position
1:complement(1998945..1999646)
Genome map
AA seq 233 aa AA seqDB search
MAKRIFEIYRYDPDKDAAPRMQTYELEIQHERMLLDALVKLKSVDETLSFRRSCREGVCG
SDAMNINGKNGLACLTNLNDLPQKIVLRPLPGLPVVRDLICDFTQFFNQYHSIRPYLIND
EPPPEKERLQSPEERDELDGLYECILCASCSTSCPSFWWNPDKFVGPAGLLQAYRFIADS
RDRATGERLDNLDDPYRLFRCHTIMNCVDVCPKGLNPTKAIGKIKELMVRRAV
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacgcattttcgaaatctaccgctacgatccggacaaggacgccgcgccgcgc
atgcagacgtacgagctggagatccagcacgagcggatgctgctcgatgcgctcgtcaag
ctgaagtcggtcgacgagacgctgtcgttccgccgctcgtgccgcgaaggcgtgtgcggc
tcggacgcgatgaacatcaacggcaagaacggcctcgcgtgcctgacgaacctgaacgac
ctgccgcagaagatcgtgctgcgtccgctgccgggcctgcctgtcgtgcgcgatctgatc
tgcgacttcacgcagttcttcaaccagtaccactcgatccgcccgtacctgatcaacgac
gagccgccgcccgagaaggagcgtctgcaatcgccggaagagcgcgacgagctcgacggc
ctgtacgagtgcattctgtgcgcgagctgctcgacgtcgtgcccgagcttctggtggaat
ccggacaagttcgtcggcccggcgggcctgctgcaggcgtatcgcttcatcgcggacagc
cgcgatcgcgcgacgggcgagcgcctcgacaacctcgacgatccgtatcgcctgtttcgc
tgccacacgatcatgaactgcgtcgacgtgtgcccgaagggcctgaacccgacgaaggcg
atcggcaagatcaaggaattgatggttcgtcgcgcggtctga

DBGET integrated database retrieval system