KEGG   Burkholderia pseudomallei HBPUB10134a: DR55_118Help
Entry
DR55_118          CDS       T03422                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bpsh  Burkholderia pseudomallei HBPUB10134a
Pathway
bpsh00620  Pyruvate metabolism
bpsh00680  Methane metabolism
bpsh00710  Carbon fixation in photosynthetic organisms
bpsh01100  Metabolic pathways
bpsh01120  Microbial metabolism in diverse environments
bpsh01200  Carbon metabolism
Module
bpsh_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bpsh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DR55_118
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    DR55_118
   00680 Methane metabolism
    DR55_118
Enzymes [BR:bpsh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DR55_118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 FAD-oxidase_C
Motif
Other DBs
NCBI-ProteinID: AIP50245
LinkDB All DBs
Position
1:147648..150632
Genome map
AA seq 994 aa AA seqDB search
MKSSGSARATRRNAVSSSSAPAHAEPPARRAAKPARKLDGAAARPLAPTNAASAKPQGRT
REDKDRPLFEDIRYLGRLLGDVVREQEGDAVFDVVETIRQTAVKFRREDDKAAAQTLEKM
LRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSAAQAGTVAYALDKFKQA
GDASSKTIKQFFEGALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQPLTARELAHNE
ALLRARVTTLWQTRMLRDARLTVADEIENALSYYRATFLDELPALYADIEEALAEHGLRA
RVPAFFQMGSWIGGDRDGNPNVTAATLDEAISRQAAVIFEHYLEQVHKLGAELSVSNLLV
GASDALKALAAASPDQSPHRVDEPYRRALIGVYTRLAASARVRLGEGTVPVRSAGRGAAP
VRATPYADAEEFAADLRVLTDSLALHHGESLATPRLAPLMRAAEVFGFHLASIDLRQSSD
IHEAVVAELLARGGVEADYAALPEADKLRVLLAALADPRPLRSPYLDYSDLAKSELGVLE
RAHAIRAQFGARAVRNYIISHTETVSDLVEVLLLQKETGLFEGTLGTPHANARNGLMVIP
LFETIADLRNASDIMRAFFALPGVGELLAHQGHEQEVMLGYSDSNKDGGFLTSNWELYRA
ELALVDLFDERGIKLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQGEVIASK
FANPEIGRRNLETVVAATLEATLAPHSNAPKQLPAFEAAMQTLSDAAMASYRALVYETPG
FTDYFFSSTPITEIAELNIGSRPASRKLQDPKNRKIEDLRAIPWGFSWGQCRLLLTGWYG
FGSAVAAYLDGAPDAAERGKRVALLKKMNKTWPFFANLLSNMDMVLAKTDLAVASRYAQL
VADKKLRKHVFERIVAEWHRTADALAEITGAHARLAANPLLARSIKNRFPYLDPLNHLQV
ELIKRHRAGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcttccggatcggcgcgcgcgacgcgccgcaatgctgtctcgtcctcttccgcc
ccggcgcacgccgagccccccgcccgccgcgccgcgaaacccgcacgcaagctcgacggc
gccgccgcgcgcccgctcgcgccgacgaacgccgcatccgcgaaaccgcaaggccgcacg
cgcgaagacaaggaccgcccgctcttcgaggacattcgctatctcggccgcctgctcggc
gacgtcgttcgcgaacaggaaggcgacgccgtgttcgacgtcgtcgagacgattcgccag
accgcggtcaagttccgccgcgaggacgacaaggccgccgcgcagacgctcgagaaaatg
ctgcgcaagctcacgcccgagcagacggtgagcgtcgtgcgcgcgttcagctatttctcg
cacctcgcgaacatcgccgaggaccgccatcacaaccgccgccgccgcatccacgcgctc
gcgggctccgcggcgcaggcgggcaccgtcgcgtacgcgctcgacaagttcaagcaggcg
ggcgacgcgtcgtcgaagacgatcaagcagttcttcgaaggcgcgctgatcgtgcccgtg
ctcaccgcgcacccgaccgaggtgcagcgcaagagcattctcgacgcgcagcacgacatc
gcgcggctgctcgccgagcgcgaccagccgctgaccgcgcgcgagctcgcgcacaacgag
gcgctgctgcgcgcgcgcgtgacgacgctctggcagacccggatgctgcgcgacgcgcgc
ctgaccgtcgccgatgagatcgagaacgcgctgtcgtactaccgcgcgacgttcctcgac
gagctgcccgcgctctacgcggacatcgaggaggcgctcgccgagcacggcctgcgcgcg
cgcgtgccggcgttcttccagatgggcagttggatcggcggcgaccgcgacggcaacccg
aacgtcaccgccgcgacgctcgacgaggcgatcagccgccaggcggcggtgatcttcgag
cattacctcgaacaggtgcacaagctcggcgcggagctgtccgtgtcgaacctgctcgtc
ggcgcgagcgacgcgctcaaggcgctcgccgccgcgtcgccggaccagtcgccgcaccgc
gtcgacgagccgtaccgccgcgcgctgatcggcgtctacacgcggctcgcggccagcgcg
cgcgtgcggctcggcgagggcacggtgcccgtgcgcagcgcgggccgcggcgccgcgccc
gtgcgcgcgacgccgtacgcggacgcggaggagttcgccgccgatctgcgcgtgctgacc
gattcgctcgcgctgcatcacggcgaatcgctcgcgacgccgcgcctcgcgccgctcatg
cgcgcggccgaggtgttcggcttccatctcgcgagcatcgatttgcggcagagctcggac
atccatgaagcggtggtcgccgaactgctcgcgcgcggcggcgtcgaggccgactacgcg
gcgctgcccgaagcggacaagctgcgcgtgctgctcgcggcgctcgcggacccgcggccg
ctgcgctcgccgtatctcgactactcggacctcgcgaagagcgagctcggcgtgctcgag
cgcgcgcacgcgatccgcgcgcagttcggcgcgcgcgcggtgcgcaactacatcatttcg
cataccgagacagtgagcgatctcgtcgaggtgctgctgctgcagaaggaaacgggcctc
ttcgagggcacgctcggcacgccgcacgcgaacgcgcgcaacggcctgatggtgattccg
ctcttcgagacgatcgccgacctgcgcaacgcgtccgacatcatgcgcgcgttcttcgcg
ctgccgggcgtgggcgagctgctcgcgcaccagggccacgagcaggaagtgatgctcggc
tattcggacagcaacaaggacggcggcttcctcacgtcgaactgggagctctatcgcgcg
gaactggcgctcgtcgatctgttcgacgagcgcgggatcaagctgcgcctgttccatggc
cgcggcggcacggtgggacgcggcggcggcccgacctatcaggcgatcctgtcgcagccg
cccggcacggtaaacggccagatccggctcaccgagcagggcgaggtgatcgcgagcaag
ttcgcgaacccggagatcggccggcgcaatctggagacggtcgtcgccgcgacgctcgag
gcgacgctcgcgccgcacagcaacgcgccgaagcagttgcccgcgttcgaggcggcgatg
cagacgctgtcggacgcggcgatggcgtcgtaccgcgcgctcgtctacgagacgcccggc
ttcaccgactacttcttctcgtcgacgccgatcaccgagatcgccgagctgaacatcggc
agccggcccgcgtcgcgcaagctgcaggatccgaagaaccgcaagatcgaggacctgcgc
gcgattccgtggggcttctcatggggccagtgccggctgctgctcaccggctggtacggc
ttcggcagcgcggtcgccgcgtatctcgacggcgcgccggacgcggccgagcgcggcaag
cgcgtcgcgctgctgaagaaaatgaacaagacctggccgttcttcgcgaacctgctgtcg
aacatggacatggtgctcgcgaagaccgatctcgcggttgcgtcgcgctacgcgcagctc
gtcgccgacaagaagctgcgcaagcacgtgttcgagcggatcgtcgccgaatggcatcgc
acggcggatgcgctcgccgagatcaccggcgcgcacgcgcggctcgccgcgaatccgctt
ctcgcgcgctcgatcaagaaccgcttcccgtacctcgatccgctgaaccacctgcaagtc
gagctgatcaagcggcaccgcgcgggcgacacgaacgcgcggctgcggcgcgggatccat
ctgacgatcaacgggatcgcggccggcctgcgcaatacgggctga

DBGET integrated database retrieval system