KEGG   Burkholderia pseudomallei HBPUB10134a: DR55_153Help
Entry
DR55_153          CDS       T03422                                 

Gene name
cobT
Definition
(GenBank) nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase
  KO
K00768  nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase [EC:2.4.2.21]
Organism
bpsh  Burkholderia pseudomallei HBPUB10134a
Pathway
bpsh00860  Porphyrin and chlorophyll metabolism
bpsh01100  Metabolic pathways
Module
bpsh_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:bpsh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DR55_153 (cobT)
Enzymes [BR:bpsh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.21  nicotinate-nucleotide---dimethylbenzimidazole phosphoribosyltransferase
     DR55_153 (cobT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DBI_PRT ABC_tran AAA_21 SMC_N Ifi-6-16 RsgA_GTPase AAA_23 AAA_29 AAA_16 DnaB_C AAA_33 SRP54 AAA_24
Motif
Other DBs
NCBI-ProteinID: AIP51003
LinkDB All DBs
Position
1:complement(191278..193200)
Genome map
AA seq 640 aa AA seqDB search
MTMHDAPTSRPTRYGTRHLVLKAGARTLLDDFTHTFEPGELWCVAGPNGAGKTTLITTLA
GLAKPAAGHVEADGAPLAAWRPEALARRRAWMAQTLHDAFSASVLDTVLLARFPHLPGWG
WERADDHAAARAALARLGLEAFAARDVLSLSGGERQRVALAAALCQDAPLLLLDEPLAHL
DLHHQIDCLAALADWLRAGERTAIFSCHDLNLARRFATHALLLDGEGGAHAGPVRDVLTP
ERASRAFGYPLVLIERDGHEALVPAWPDARACPDRRASRNPFHPRDEPMTTSTFSLPSVD
PLDDAALRATLARIIDHKTKPPGSLGRLEALALQLGMIQRTSAPSVARPAMIVFAGDHGI
AAEGVSPYPQAVTAQMVANFVAGGAAINAFSRVAGLALEIVDAGVASPLPASPQLVDAAI
ARGTRNFAQERAMSRDEALAALAAGAARVRHHAALGTNVIGFGEMGIANTSAAACMMSRL
LDVPIDACVGRGTGLDDAGLAHKRAVLGRALERHAHAREPLDVLAAFGGFEIAMIAGAFI
EAAHARMAILVDGFIATSALLVADALAPAVREYCVFSHVSNEAGHRRMLEHLGGEPLLAL
DLRLGEGTGAALALPLVRAAAAFVNEMASFESAGVANRDA
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgcacgacgcgccgacctcgcgcccgacccgctacggcacgcggcatctcgtg
ctgaaggcgggcgcgcgcacgctgctcgacgatttcacgcacacgttcgagccgggcgag
ctgtggtgcgtggccggcccgaacggcgcgggcaagacgacgctcatcacgacgctcgct
gggctcgcgaagcccgccgccgggcacgtcgaagcggacggcgcgccgctcgccgcgtgg
cggcccgaagcgctcgcgcggcggcgcgcgtggatggcgcagacgctgcacgacgcgttc
agcgcgagcgtgctcgataccgtgctgcttgctcgcttcccgcatctgccgggctggggc
tgggagcgcgccgacgatcacgcggccgcgcgcgcggcgctcgcgcggctcgggctcgaa
gcgttcgccgcgcgcgacgtgctgtcgctgtcgggcggcgagcggcagcgcgtcgcgctc
gcggccgcgctgtgccaggacgcgccgctgctgttgctcgacgagccgctcgcgcacctc
gacctgcatcaccagatcgactgtctcgccgcgctcgccgattggctgcgcgcgggcgag
cgcaccgcgatcttctcgtgccacgacctgaatctcgcgcgccgcttcgcgacgcacgcg
ctgttgctcgacggcgagggcggcgcgcacgcgggcccggtgcgcgacgtgctcacgccc
gagcgcgcgagccgcgcgttcggctatccgctcgtgctgatcgagcgcgacggccacgag
gcgctcgtgcccgcgtggcccgatgcgcgcgcctgccctgatcgacgcgcatcacgcaac
ccctttcatccacgagacgaaccgatgacgacctcaaccttttccctgccgagcgtcgat
ccgctcgacgacgccgcactgcgcgcgacgctcgcacgcatcatcgatcacaagacgaag
ccgcccggcagcctcggccgtctcgaagcgctcgcgctgcagctcggcatgatccagcgc
acgagcgcgccgagcgtcgcgcgcccggcgatgatcgtgttcgccggcgatcacgggatc
gccgccgaaggcgtgagcccgtatccgcaggcggtgaccgcgcagatggtcgcgaacttc
gtcgcgggcggcgcggcgatcaacgcgttctcccgcgtcgcgggcctcgcgctcgagatc
gtcgatgcgggcgtcgcgtcgccgctgccggcttcgccgcagctcgtcgacgccgcgatc
gcgcgcggcacgcgcaacttcgcgcaagagcgcgcgatgtcgcgggacgaagcgctcgcc
gcgctcgccgcgggcgccgcgcgcgtgcggcatcacgcggcgctcggcaccaacgtgatc
ggcttcggcgagatggggatcgcgaacacctcggcggccgcgtgcatgatgagccgcctg
ctcgacgtgccgatcgacgcgtgcgtcggccgcggcacgggcctcgacgacgcgggcctc
gcgcacaagcgcgcggtgctcgggcgcgcgctcgagcggcacgcgcacgcgcgcgagccg
ctcgacgtgctcgccgcgttcggcggcttcgagatcgcgatgatcgcgggcgcgttcatc
gaagcggcgcacgcgcgcatggcgattctcgtcgacggcttcatcgcgacgtcggcgctg
ctcgtcgccgacgcgctcgcgcccgcggtgcgcgaatactgcgtgttctcgcacgtatcg
aacgaagcggggcatcggcgcatgctcgagcacctcggcggcgagccgctcctcgcgctc
gacctgcgtctcggcgagggcacgggcgccgcgctcgcgctgccgctcgtgcgcgcggcg
gcggcgttcgtcaacgagatggcgagcttcgaatcggcgggcgtggcgaaccgcgatgcg
tga

DBGET integrated database retrieval system