KEGG   Burkholderia pseudomallei HBPUB10134a: DR55_3016Help
Entry
DR55_3016         CDS       T03422                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bpsh  Burkholderia pseudomallei HBPUB10134a
Pathway
bpsh00020  Citrate cycle (TCA cycle)
bpsh00310  Lysine degradation
bpsh00380  Tryptophan metabolism
bpsh01100  Metabolic pathways
bpsh01110  Biosynthesis of secondary metabolites
bpsh01120  Microbial metabolism in diverse environments
bpsh01130  Biosynthesis of antibiotics
bpsh01200  Carbon metabolism
Module
bpsh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpsh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpsh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DR55_3016 (sucB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    DR55_3016 (sucB)
   00380 Tryptophan metabolism
    DR55_3016 (sucB)
Enzymes [BR:bpsh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     DR55_3016 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AIP50255
LinkDB All DBs
Position
1:complement(3485597..3486874)
Genome map
AA seq 425 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV
LQNDGDTVVADQVIATIDTEAKAGAAAAAAGAADVQPAAAPVAAPAPAAQPAAAAASSTA
AASPAASKLMAEKGIGAGDVAGSGRDGRITKGDVLSAGSAPAAAPAAAPAKAAAKPALPE
VKVPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVMDLRAKY
KDKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLV
VPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINP
PQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPAR
LLLDL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagctttcggagtcggtttcggaagcgaccatg
ctgcagtggaagaagaagcccggcgaagccgtcgcgcaggacgaaatcctgatcgagctc
gagacggacaaggtcgtcctcgaagtgccggcgccggccgcgggcgtgctcgcgcaagtg
ctgcagaacgacggtgacacggtcgtcgccgaccaggtgatcgcgaccatcgacaccgaa
gcgaaggcaggcgccgccgcggcagcggcaggcgccgccgacgttcagccggccgccgct
cccgtcgccgcgccggcgcccgccgcacagccggccgccgccgccgcgtcgagcaccgcg
gccgcatcgcccgccgcgtcgaagctgatggccgagaagggcatcggcgccggcgacgtc
gccggctcgggccgcgacggccgcatcacgaagggcgacgtgctgtccgcgggcagcgcg
ccggccgccgcgccggccgccgcgccggcgaaggccgccgcgaagccggcgctgccggaa
gtgaaggtgccggcatcggcgacgacgtggctcaacgaccgtccggagcagcgcgtgccg
atgtcgcgcctgcgcgcgcgcatcgccgagcgtctgctcgaatcgcagcagaccaacgcg
atcctcacgacgttcaacgaagtgaacatgcagccggtgatggacctgcgcgcgaagtac
aaggacaagttcgagaaggagcacggcgtgaagctcggcttcatgtcgttcttcgtgaag
gcagccgttcacgcgctgaagaagttcccgctcgtgaacgcgtcgatcgacggcaacgac
atcgtctaccacggctacttcgacatcggcatcgcggtcggttcgccgcgcggcctcgtc
gtgccgatcctgcgcaacgcggatcagctgagcctcgccgagatcgagaagaagatcgcc
gaattcggccagaaggcaaaggacggcaagctgtcgatcgaggaaatgacgggcggcacg
ttctcgatctcgaacggcggcgtgttcggctcgatgctgtcgacgccgatcatcaacccg
ccgcagtcggcgatcctcggcgtgcacgcgacgaaggagcgcccggtcgtcgagaacggc
cagatcgtgatccgcccgatcaactatctcgcgctgtcgtacgaccaccggatcatcgac
ggtcgcgaagcggtgctgtcgctcgtcgcgatgaaggacgcgctcgaagatccggcgcgc
ctgctgctcgacctgtaa

DBGET integrated database retrieval system