KEGG   Burkholderia pseudomallei HBPUB10134a: DR55_4742Help
Entry
DR55_4742         CDS       T03422                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bpsh  Burkholderia pseudomallei HBPUB10134a
Pathway
bpsh00440  Phosphonate and phosphinate metabolism
bpsh01100  Metabolic pathways
bpsh01120  Microbial metabolism in diverse environments
bpsh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpsh00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    DR55_4742 (aepX)
Enzymes [BR:bpsh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     DR55_4742 (aepX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase ThiG
Motif
Other DBs
NCBI-ProteinID: AIP55156
LinkDB All DBs
Position
2:1696294..1697205
Genome map
AA seq 303 aa AA seqDB search
MPIRELISAPITNEQRRRSFKEKLATGRALRFIESHSPISAMISEKVYVAHGASQSEFDG
FWSSSLTDSTLRGRPDIEILDIASRLANVQHIFDVTTKPLIIDGDTGGKPEHFALNVQSL
ERSGVSAVIIEDKTGLKKNSLLGNDVIQHQESIEDFCEKIRVGKAAQITDDFQIIARVES
LILDKGMPDALARAAAYCEAGADGVMIHSRKKDADEVIEFAQRFRACRRDAYLVCVPTSF
NAISFSELARHFSVVIYANHLLRAAYPAMLAVAEGILAHGRTLEIEERCLPVNEILKLIP
GTA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtgccaataagagaattaataagcgcgccgattaccaacgaacaaagacgccgatcgttc
aaggaaaagctggcaaccgggcgcgcgctgcgcttcatcgaaagccacagcccgatttcc
gcaatgatcagcgaaaaggtttatgttgcgcacggagcgtctcaatccgagttcgacggc
ttctggtcgagttcactgaccgactcgacgctgcgcggccggccggacatcgaaatcctg
gatatcgcgagcaggctcgccaatgtccagcatattttcgacgtgacgacgaagccgctc
atcatcgacggcgacacgggcggcaagcccgagcatttcgcgctgaacgtgcagtcgctc
gagcgatccggcgtctcggcggtgatcatcgaggacaaaacggggttgaagaaaaattcg
ctgctcggcaacgacgtgattcagcaccaggaatcgatcgaggatttctgcgaaaagatt
cgcgtcggcaaggccgcgcagatcaccgacgattttcagatcatcgcccgcgtcgagagc
ttgattctcgacaagggcatgccggacgcgctcgcgcgcgcggccgcgtattgcgaggcc
ggcgccgacggcgtgatgatccacagccgcaagaaggacgcggacgaagtgatcgaattc
gcgcagcggttccgcgcatgccgccgcgacgcgtatctcgtgtgcgtgccgacgagcttc
aacgcgatttcgttcagcgagctcgcgcgccacttcagcgtcgtgatctacgcgaatcac
ctgctgcgcgccgcgtatccggcgatgctcgcggtcgccgagggcattctcgcgcacggc
cgcacgctcgagatcgaagaacgctgcctgcccgtcaacgagatcctgaagctcattccg
ggaaccgcgtga

DBGET integrated database retrieval system