KEGG   Burkholderia pseudomallei HBPUB10134a: DR55_5189
Entry
DR55_5189         CDS       T03422                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
bpsh  Burkholderia pseudomallei HBPUB10134a
Brite
KEGG Orthology (KO) [BR:bpsh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpsh02044]
    DR55_5189
Secretion system [BR:bpsh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   DR55_5189
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AIP54564
LinkDB
Position
2:2278625..2279206
AA seq 193 aa
MSASSSSQKFIARNRAPRVQIEYDVEVYGSEKKVELPFVMGVLADLSGKPVAPLPAVADR
RFLDIDIDNFDERMKAIKPRVAFAVDNTLSGDGQLMVDMTFESIEDFSPAAIARMVGPLR
QLLEARTQLANLQTYMDGKSGAETLVNQLLQDPALLRSLAAAPKPQLAGGPDAGNARGAK
GAPDTANHDSDAA
NT seq 582 nt   +upstreamnt  +downstreamnt
atgtccgcatccagcagctctcaaaaattcatcgcgcgcaaccgcgcgccccgcgtgcag
atcgaatacgacgtcgaagtctacggctcggaaaagaaggtcgaactgccgttcgtgatg
ggcgtgctcgccgacctgtcgggcaagccggtcgcgccgctgcccgccgtcgccgaccgg
cgcttcctcgacatcgacatcgacaacttcgacgagcggatgaaggcgatcaagccgcgc
gtggcgttcgcggtggacaacacgctgtcgggcgacgggcagctgatggtcgacatgacg
ttcgaaagcatcgaggacttctcgcccgccgcgatcgcgcgaatggtcggcccgttgcgg
caattgctcgaggcgcgcacgcagctcgcgaacctgcagacctacatggacggcaagtcc
ggcgccgaaacgctcgtcaaccagttgctgcaggacccggcgctgctgcgctcgctcgcg
gccgcgccgaagccgcagctcgcgggcgggccggacgcgggcaatgcgcgcggcgcgaag
ggcgcgcccgacacggcgaaccacgacagcgatgcggcctga

DBGET integrated database retrieval system