KEGG   Burkholderia pseudomallei HBPUB10134a: DR55_5219Help
Entry
DR55_5219         CDS       T03422                                 

Gene name
cga
Definition
(GenBank) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
bpsh  Burkholderia pseudomallei HBPUB10134a
Pathway
bpsh00500  Starch and sucrose metabolism
bpsh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpsh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DR55_5219 (cga)
Enzymes [BR:bpsh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     DR55_5219 (cga)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N CBM_20 Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AIP55480
LinkDB All DBs
Position
2:2320880..2323528
Genome map
AA seq 882 aa AA seqDB search
MSARHFGFKQAVLVGSLAALAGAAALPANTSAAAEAFGSPGAAPVRGPAAKSFLGTAVNG
ASRVYFTGYRGILSEVYYPVLDTPESVDLQFLVGDAGKTFVDEEKQQAYSAAQTDTRTMS
WQVTTGNSSHNWQIRKIVFADPNHNAIVQRVTFTALDGRKVGDFNLYMLSKPYLDNAGAN
NTAQTVSGSGGTALVANHNSRYSALVASRPWKVVNGVGMTSNGFVGQSDGWTDLLGGTAD
KTMDWTFSSATNGNVAQMGWLDLGDPSATSVSFDVVLGFGGTQDQALGDANTVLGSDLAG
EQQQYDTGWHNYAAGLSSQNGAADDGYYLAAMSLKTMQDKSNGAMIAGIGTPWGETQGDA
NAGGYHLVWPRDLFKFANALTTAGDTSSATSVVNYLFNTLQQTTDCGTAEYNAPGCAQGY
SRVGRFPQNAWVNGWPYWQGTQMDEQAMPIILAWRLGPSVFNPLWPKIKLTADYIVNTGP
WTYQERWEENAGYSPSTIAAEIAGLVTAADIATQNGDTASAARYLAAADYWQENVAAWTY
TSSGAFGNGSYYIRINPAGRAGTGTDRASFAPTAGPDTPQTLSVKNGGGSHDARRVVDGG
FFELVRMGVKRATDPTIANTISVYDSVLGQTLNVANAPALSPNAWFRYNFDGYGEHNDGG
DFDGTGAGRLWPIFTAERGMVEIARQGSGGAGSAYFSTLKQLTTPEGFVPEQVWSNSTTL
PDGWAVTTPAGYTPGQPTKSMAPLNWAMGEYISLLASIQAGRIVDVPSVVCARYNNCAAP
PQSGQVPVAVNVNASTQLGQQMYVTGNVAALGNWNTDLGIPVDPASYPVWRNTVNLPAAQ
AIQYKYYRKNADGSVTWENRSGNRQLQTPASGTLALNDQVSW
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaaggcacttcggattcaagcaggcggtgctggtgggcagtctggccgcgctc
gcgggcgcggcggccctaccggcgaatacttcggccgccgccgaagcattcggctcgccc
ggcgccgcgcccgtgcggggcccggcggccaagtcgttcctcggcacggcggtcaacggc
gcatcgcgggtgtacttcaccggttatcgcggcatcctgtccgaggtctactacccggtc
ctcgatacgcccgagtccgtcgacctgcagttcctcgtcggcgacgccggcaagaccttc
gtcgacgaagaaaagcagcaggcctactcggccgcgcaaacggacacgcgcacgatgagc
tggcaggtgacgaccggcaacagttcgcacaactggcaaattcgcaagatcgtcttcgcc
gatccgaaccacaacgcgatcgtgcagcgcgtcacgttcaccgcgctcgacggccgcaag
gtgggcgacttcaatctctacatgctgtccaagccgtacctcgacaacgccggcgccaac
aataccgcgcaaacggtgtccggcagcggcggcaccgcgctcgtcgcgaatcacaacagc
cgctattcggcgctcgtcgcgagccgcccgtggaaggtggtcaacggcgtgggcatgacg
tcgaacggcttcgtcgggcagagcgacggctggaccgacctgctcggcggcaccgccgac
aagacgatggactggaccttctcgtccgcgaccaacggcaacgtcgcgcagatgggctgg
ctcgacctcggcgatccgagcgcgacgagcgtgtcgttcgacgtcgtgctcggcttcggc
ggcacgcaggaccaggcgctcggcgacgcgaacacggtgctcggcagcgatctcgccggc
gaacagcagcagtacgacaccgggtggcataactacgcggcgggcctgtcgtcgcagaac
ggcgccgcggacgacggctactacctggccgcgatgtcgctcaagacgatgcaggacaag
agcaacggcgcgatgatcgccggcatcggcacgccgtggggcgaaacgcagggcgatgcg
aacgcgggcggctatcacctcgtgtggccgcgcgacctgttcaagttcgcgaacgcgctg
acgacggcgggcgacacgtcgagcgcgacgagcgtcgtcaactacctgttcaacacgctg
cagcagacaaccgattgcggcaccgccgaatacaacgcgcccggctgcgcgcagggctac
agccgcgtcgggcgctttccgcagaacgcatgggtgaacggctggccgtactggcagggc
acgcagatggacgagcaggcgatgccgatcatcctcgcgtggcgcctcggcccgagcgtg
ttcaatccgctgtggccgaagatcaagctcaccgccgactacatcgtcaataccggcccc
tggacgtaccaggagcgctgggaggagaacgccggctattcgccgtcgacgatcgccgcc
gagatcgcgggcctcgtcacggcggccgacatcgcgacgcaaaacggcgacacggcgagc
gccgcgcgctacctcgccgcggccgactactggcaggagaacgtcgcggcgtggacgtac
acgtcgagcggcgcgttcggcaacggcagctactacatccggatcaatccggcgggccgc
gcgggcaccggcaccgaccgcgcgagcttcgcgccgaccgccggccccgacacgccgcag
acgctgagcgtgaagaacggcggcggcagccacgacgcgcggcgcgtcgtcgacggcggc
ttcttcgagctcgtccgaatgggggtcaagcgcgcgaccgatccgacgatcgccaacacg
atctcggtctacgacagcgtgctcggccagacgctgaacgtcgcgaacgcgccggcgctg
tcgccgaacgcgtggttccgctacaacttcgacggctacggcgagcacaacgacggcggc
gatttcgacggcaccggcgccggccggctgtggccgatcttcaccgccgagcgcggcatg
gtcgagatcgcgcgccagggcagcggcggcgcgggcagcgcgtacttctcgacgctcaag
caattgacgacgcccgagggcttcgtgccggagcaggtgtggtcgaattcgacgacgctg
cccgacggctgggcggtgacgacgcccgcgggctacacgccgggccagccgaccaaatcg
atggcgccgctcaactgggcgatgggcgaatacatcagcctgctcgcgtcgatccaggcg
gggcgcatcgtcgacgtgccgtcggtggtctgcgcgcgctacaacaactgcgccgcgccg
ccgcaaagcgggcaggtgccggtggccgtcaacgtgaacgcgagcacgcagctcggccag
cagatgtacgtgacaggcaacgtcgccgcgctcggcaactggaacaccgatctcggcatt
ccggtcgatccggccagctacccggtgtggcgcaacaccgtcaacctgccggccgctcag
gcgatccagtacaagtactaccggaagaacgcggacggcagcgtgacgtgggagaaccgt
tccggcaaccgccagcttcagacgcccgcgagcggcacgttggcgctgaacgatcaggtg
agctggtga

DBGET integrated database retrieval system