KEGG   Burkholderia pseudomallei HBPUB10134a: DR55_5469Help
Entry
DR55_5469         CDS       T03422                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur family protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bpsh  Burkholderia pseudomallei HBPUB10134a
Pathway
bpsh00020  Citrate cycle (TCA cycle)
bpsh00190  Oxidative phosphorylation
bpsh00650  Butanoate metabolism
bpsh01100  Metabolic pathways
bpsh01110  Biosynthesis of secondary metabolites
bpsh01120  Microbial metabolism in diverse environments
bpsh01130  Biosynthesis of antibiotics
bpsh01200  Carbon metabolism
Module
bpsh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpsh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bpsh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bpsh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DR55_5469
   00650 Butanoate metabolism
    DR55_5469
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DR55_5469
Enzymes [BR:bpsh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DR55_5469
    1.3.5.4  fumarate reductase (quinol)
     DR55_5469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4_4
Motif
Other DBs
NCBI-ProteinID: AIP53328
LinkDB All DBs
Position
2:2647220..2647927
Genome map
AA seq 235 aa AA seqDB search
MADTRILDIYRYDPDDGRAPRMQRYELAPRAEDRMLLDVLGRVKAQDETLSYRRSCREGV
CGSDAMNINGRNGLACVTSMQALPREIVLRPLPGLPVVRDLIVDMTSFFNQYHSVRPYLV
NEGVPPERERLQTPQEREQLDGLYECILCACCSSACPSYWWNPDKFVGPAGLLQAYRFIV
DSRDDASAARLDDLEDPYRLFRCRTIMNCVDVCPKGLNPARAIGQIRTMLARRAV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggccgacacccgcattctcgacatctaccgctacgatccggacgacgggcgcgcgccg
cgcatgcagcgctatgagctcgcgccgcgcgcggaagaccggatgctgctcgacgtgctc
ggccgcgtgaaggcgcaggacgagacgctgtcgtatcgccgctcgtgccgcgagggcgtg
tgcggctccgacgcgatgaacatcaacggccgcaacgggctcgcctgcgtgacgagcatg
caggcgctgccgcgcgaaatcgtgctgcggccgctgccggggctgcccgtcgtgcgcgat
ctgatcgtcgacatgacgagcttcttcaatcagtaccattcggtccgcccgtatctcgtc
aacgaaggcgtgccgcccgaacgagagcgcctgcagacgccgcaagagcgcgagcagctc
gacggcctctacgaatgcatcctgtgcgcgtgctgctcgagcgcgtgcccgagctactgg
tggaatcccgacaagttcgtcgggccggcggggctgctgcaggcgtaccgcttcatcgtc
gattcgcgtgacgacgcgagcgccgcgcgcctcgacgatctcgaggacccgtaccggctg
ttccgctgccggaccatcatgaactgtgtcgatgtctgtccgaaaggcctgaacccggcg
cgcgcgatcggacagatccgcacgatgctcgcgcggcgcgcggtatag

DBGET integrated database retrieval system