KEGG   Burkholderia pseudomallei HBPUB10134a: DR55_902Help
Entry
DR55_902          CDS       T03422                                 

Definition
(GenBank) polyphosphate kinase 2 family protein
Organism
bpsh  Burkholderia pseudomallei HBPUB10134a
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PPK2 T2SSE Metal_resist
Motif
Other DBs
NCBI-ProteinID: AIP51502
LinkDB All DBs
Position
1:complement(1057838..1058677)
Genome map
AA seq 279 aa AA seqDB search
MAKQPSLDDYRVPYHTREKEAAAFTFDAFDPAAKPFSSGSKETDRERLSAVALQLDTLQE
RLHTQRHKRMLLVLQGMDSSGKDGTVRAVFHEVDPLGLRIVSFKAPTPVERSHDFLWRVH
AQAPAAGELTIFNRSHYEDVLVPRVTAEIDKAECERRYRQIRQFEEMLAESGTRLVKCFL
HISKDEQRARLQARIDDPNKHWKFDISDLEARKHWDAYQAAYRDALAATSAEHAPWYVIP
ADSKTHRNVMIAELLLRELTAMKLEYPPAKPELAGIQIQ
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcaaccgtcgctcgacgactaccgcgtgccgtatcacacgcgtgaaaaagaa
gccgccgcgttcacgttcgacgcgttcgatccggccgcgaagccgttctcgagcggatcg
aaggaaaccgaccgcgagcggctgtccgccgtcgcgttgcagctcgacacgctgcaggag
cgcctgcatacgcagcggcacaagcgcatgctgctcgtgctgcaggggatggactcgagc
ggcaaggacggtaccgtgcgcgcggtgtttcacgaagtcgacccgctcgggctgcgcatc
gtgtcgttcaaggcgcccacgcccgtcgagcgctcgcacgatttcctctggcgcgtgcat
gcgcaggcgcccgccgccggcgagctgacgatcttcaaccgcagccattacgaggacgtg
ctcgtgccgcgcgtgacggccgagatcgacaaggccgagtgcgagcggcgctacaggcag
atccggcagttcgaggagatgctcgccgaatccggcacgcggctcgtcaagtgcttcctg
cacatctcgaaggacgagcagcgcgcgcggttgcaggcgcgcatcgacgatccgaacaag
cactggaagttcgatatttcggatctcgaagcgcgcaagcactgggacgcatatcaggcc
gcgtaccgcgacgcgctcgccgcgacgtcggccgagcatgcgccgtggtacgtgatcccg
gccgattcgaagacgcatcgcaacgtgatgatcgccgagctgctgctgcgcgagctgacc
gcgatgaagctcgaatacccgcccgcgaagcccgagctcgccggcatccagatccaataa

DBGET integrated database retrieval system