KEGG   Basilea psittacipulmonis: IX83_03565Help
Entry
IX83_03565        CDS       T03226                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bpsi  Basilea psittacipulmonis
Brite
KEGG Orthology (KO) [BR:bpsi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    IX83_03565
Enzymes [BR:bpsi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     IX83_03565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 HI0933_like DAO Thioredoxin_3 FAD_oxidored FAD_binding_3 NAD_binding_8 Thi4 K_oxygenase AlaDh_PNT_C Glutaredoxin Lycopene_cycl NAD_binding_9 FMO-like DUF777
Motif
Other DBs
NCBI-ProteinID: AIL32505
UniProt: A0A077DC87
LinkDB All DBs
Position
786828..788372
Genome map
AA seq 514 aa AA seqDB search
MLDEAIKLQLKTYLERVSLPIELQANLGSDEKSAELKTLLEEIATLSDKVTYKEVSTSGR
QPAFSIVRTGTDIAVTFAGIPMGHEFSSLVLALLQVGGYPAKLSDEVVQQIKNLPGEYVF
ETYFSLSCQNCPDVVQALNAMSVINPKIKHVAIDGALFQDEVERLEIMSVPAVYLNGELF
GQGRSNVEEILAKLDTGAADRKAQELSQKEPFDVLVIGGGPSGSAAAVYAARKGIRTGVV
AERFGGQVQDTNDIENFISVLKTEGPHLASALEEHVRSYGVDIMNMQRAAKLIPGEQDIT
VELESGATLKAKSVILSTGARWRNMNVPGEEEYRTKGVAYCPHCDGPLFKGKDVAVIGGG
NSGVEAAIDLAGVVKHVTLIERNPQLRADEVLQRKLRSLENVTIITNGATLEVHGDGKKV
NGLSYQDLETEEVKRLDLEGIFVQIGLVPNTEWLKGTVALSKFGEIEIDNRCHTSVKGVF
AAGDCTTVPYKQIIIAMGEGAKASLSAFDHLIRS
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgaagcgattaaattacaactcaaaacctatttagaacgcgtcagtttgccc
attgagttgcaagcaaacttaggatcggatgagaagtctgcagagttaaaaactttatta
gaagaaattgcgactttaagtgataaagtaacttataaagaagtgtcaacctctggtcgt
caacctgcgttttctattgtgcgtacgggtaccgatattgccgtgacgtttgcaggtatt
cccatgggacatgagttttcatccttggtgttggccctattgcaagtaggagggtatcct
gcgaaattatctgacgaagtggtgcaacagattaagaatttacctggcgagtatgtgttt
gaaacttatttctctttgtcttgccagaattgtcctgatgtcgttcaagcattaaatgcg
atgtcagttattaatccaaaaattaagcatgtcgctatcgatggtgcgttgttccaagat
gaagtagaacgtttggaaattatgtctgtgccagccgtttatttaaacggtgagttgttt
ggtcaaggacgttctaacgttgaagagattttggctaaattagatacgggtgctgctgat
cgcaaagctcaagaattatcacaaaaagaaccttttgatgtattggttattggtggcggt
ccatctggttcagctgcggcggtgtatgcagctcgtaaagggattcgtactggcgtggta
gctgaacgttttggaggtcaagttcaagacacgaatgatattgaaaactttatttctgta
ttgaaaacagaagggcctcatttagccagtgccttagaagaacatgtccgttcatatggc
gtggatattatgaatatgcaacgtgcggccaaacttatcccaggtgagcaggacattaca
gtagagttagaaagcggggcgacattaaaagctaaatccgtgattctttcaacaggggca
cgttggcgtaatatgaatgtgcctggcgaagaggaatatcgtacaaaaggtgtggcttat
tgtccgcattgtgatggtcctttgttcaaaggcaaagatgttgcggtcattggtggtggt
aactcaggcgtggaagcagccattgacttggcaggtgtggtgaaacacgtgaccttgatt
gaacgtaacccacaattacgtgccgatgaggtattacaacgtaaacttcgcagtttagag
aatgtgaccatcatcactaatggtgctactttggaggtgcatggcgatggtaagaaagtc
aatggattaagttaccaagaccttgaaactgaagaagtgaaacgtttagacttagagggt
atctttgtacaaattggtttggtgcctaataccgagtggttaaaaggtacggtggcatta
agcaagtttggtgagattgaaattgataatcgttgccatacctctgtgaaaggtgtattt
gcggcaggtgattgtacgaccgtgccatataagcaaatcattattgcgatgggagaaggt
gcaaaagcctctttatcggcgtttgatcatttgattcgttcataa

DBGET integrated database retrieval system