KEGG   Basilea psittacipulmonis: IX83_03610Help
Entry
IX83_03610        CDS       T03226                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
bpsi  Basilea psittacipulmonis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: AIL32513
UniProt: A0A077DH78
LinkDB All DBs
Position
complement(799578..800672)
Genome map
AA seq 364 aa AA seqDB search
MGVMKAAAFIDKNRIEIVEKKIPDVGPNDALIRITTTTICGTDVHILKGEYPVAKGLTVG
HEPVGIIEKLGSNVKGYEEGQRVIAGAICPSFTSYPCQDGYPSQDGSYLMENGVCSCHGY
KATAGWRFGNMIDGTQAEYVLVPDAQANLAPIPDGLTDEEVLMCPDIMSTGFKGAENANI
EIGDIVAIFAQGPIGLCATAGARLKGASVIIAIDGNNERLEIAKKLGATVTLNFKEVDII
DEVMKLTNGRGVDASIEALGTQKTFEQALAILKPGGTLSSLGVYSQDLVIPLKYFAAGLG
DHKINTALCPGGKERMRRLMNVIRSGNVDLKPLVTHQFKLDDIVEAYDLFANQRDGVLKV
AIKP
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtaatgaaagctgctgccttcatcgacaaaaatagaatagaaattgttgagaag
aaaattccagatgtaggtcctaacgatgctttgattcgcatcacgaccacgaccatatgt
ggcaccgatgtgcatattttaaaaggggaataccctgttgccaaaggtttaaccgtcggt
cacgaaccagtgggaattattgaaaaactaggttcaaatgtcaaaggatatgaagaggga
caaagggtgattgctggcgctatttgcccaagttttacttcttatccatgtcaggatggc
tacccctctcaagatggttcttaccttatggaaaatggcgtttgctcatgccatggctat
aaagcaacagcgggttggcgttttggaaatatgatagatggcacccaagccgaatacgtg
cttgtgccagacgcacaggctaaccttgccccaattcctgatggactcacggacgaagaa
gtattgatgtgtcctgatattatgtcaacaggcttcaaaggtgctgaaaacgcgaacatt
gaaatcggtgacatcgttgccatctttgcccaaggccctattggtctatgtgcaactgca
ggtgcaagattaaaaggtgccagcgtcatcattgcgatcgatggtaataacgaacgtctc
gaaatcgccaaaaaacttggagcaaccgttaccttgaactttaaagaagtcgatattatt
gatgaggtgatgaaactgacgaatggccgtggcgtggacgctagtattgaggcacttggc
acacaaaaaacatttgaacaagctctagccatcctgaaacctggtggcaccttgtctagt
ttgggtgtgtactctcaagacttagtcatcccgttgaagtattttgctgcgggattaggt
gatcataagattaacacagctctatgccctggaggcaaagaacgcatgcgtcgtttgatg
aatgtgattcgtagcggtaatgtggatctcaaaccacttgtcacacaccaatttaaacta
gacgatattgttgaagcttatgatctatttgccaaccaaagagatggcgtattgaaagta
gcgattaaaccttaa

DBGET integrated database retrieval system