KEGG   Burkholderia pseudomultivorans: WS57_00115
Entry
WS57_00115        CDS       T04870                                 

Definition
(GenBank) type VI secretion system protein ImpK
  KO
K11892  type VI secretion system protein ImpK
Organism
bpsl  Burkholderia pseudomultivorans
Pathway
bpsl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpsl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    WS57_00115
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpsl02044]
    WS57_00115
Secretion system [BR:bpsl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   WS57_00115
SSDB
Motif
Pfam: DotU gp12-short_mid
Other DBs
NCBI-ProteinID: AOI87313
LinkDB
Position
2:30954..31895
AA seq 313 aa
MSRISSATQSGSAPKIVSARRASAPPQRPNGTLLSNRDPRQQPGSRRNRPFGPLAPPEDE
PTRLAAVLGHRNALLEAGRVLLRALVDMPALIDTGHDARLRDLLLEEVRVFERLCVRANI
REDHRIGARYCLCTALDEAAMRVLAARGDASGSVAWASDALTQRIGEDNQGGSKVYALTL
RLLDDAADHWPLLELIYRIFSLGFEGRYPNGRTFSAHDRVRERIYNAIAAHLPTVPNALS
PHATTIESARPRACFEMPVWLSAALLSAALCALYVYCRIESGAQADDVQRQLSNIARIAP
YSAIDPPQGDPAR
NT seq 942 nt   +upstreamnt  +downstreamnt
atgagccgaatttcgagcgcgacgcaatccggtagcgcgcccaaaatcgtgtcggcgaga
cgcgcgtccgcaccaccgcaacggccaaacggcacgttgctctccaacagggatccacga
cagcaacctgggtcgcgccgtaatcgtccattcgggccacttgcgccgcccgaggacgaa
ccgacgagactggcagcggtacttgggcaccgtaacgccttgctggaagcgggcagggtg
ctgcttcgagcattggtggacatgcccgcgctgatcgacaccggccacgacgcacgcctg
cgcgacctgctgctggaagaagttcgcgtattcgagcgcctgtgcgtacgggccaacatc
cgcgaggatcacaggattggcgcccgatattgcctgtgcactgcactggacgaagctgcg
atgcgcgtactggcggcgcgcggcgacgcgtcgggaagcgttgcatgggcgtcagacgcg
ctgacccaacgaatcggcgaggataaccagggcggctcgaaagtctacgcgcttacgctg
cgtttgttggatgacgccgccgaccattggccgttgctcgaactgatctaccggattttc
agcctggggtttgaaggccggtatccgaatggccggacgttcagcgcgcacgaccgcgta
cgagagcgaatctacaacgcgattgcggcgcatctacccaccgtcccgaacgcgctgtcg
ccccacgccacgacgatcgaatcggcgcgaccgagagcctgtttcgaaatgccggtgtgg
ctgtcggcggccctgctgtcagcggcgctctgcgcgctgtacgtctattgccgcatcgag
tcaggggcgcaagccgacgacgtgcagcgacaactttccaacatcgcgcgcatcgcgcca
tacagcgcaatcgatccgccgcagggcgatccggcgcgctag

DBGET integrated database retrieval system