KEGG   Burkholderia pseudomultivorans: WS57_00120
Entry
WS57_00120        CDS       T04870                                 

Definition
(GenBank) type VI secretion protein VasK
  KO
K11891  type VI secretion system protein ImpL
Organism
bpsl  Burkholderia pseudomultivorans
Pathway
bpsl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpsl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    WS57_00120
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpsl02044]
    WS57_00120
Secretion system [BR:bpsl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   WS57_00120
SSDB
Motif
Pfam: IcmF-related IcmF-related_N IcmF_C PriCT_1
Other DBs
NCBI-ProteinID: AOI87314
LinkDB
Position
2:31924..35925
AA seq 1333 aa
MKKILSFLSSRHLRAVVMVIAAVVAIWFAGPLLSFGGLNPLASIDIRLTLIALVLAAWVL
WLIDWTTSIVTVVLLSLAIWHAFPLVTLSGEPLFASVTFRILAMTGVVAVYAAVMSIRWW
RQMRRHPGRLRRLLRLGKRGARPLAASRLAEIEDMARATIAQLKAGRGAGGRLARLFRGA
AHLYDVPWYVVLGPRGSGKTAMLLNSGLPFPLDARLQHSLAPNDARALPGWRLTNEAVLI
DTAGHYVQHGTSRYSLPLASSHRPSDGKPKNQPPDMAAIRRQSDAAEWQGFLRLLRRIRP
RLPLNGVLLTIDVAALAHANPAAHTTESRALRARVEEMQAEFGTGFPVWLVVTKMDRLPG
FADYFASLGEAERAQIWGVTLGSDLQARMNDALRTGLNLLATRLADGVTSLLRNETDMDR
RRRLATLPESVAALVNPLGDLIEHVFARDHNGGPTGPRAMFRGVYLTSASQGDHPVAAER
RTLLRRMIDASGTTRRNPRPTPGETSYFLRDLWSGIVFREGHLAIPNRNREHRARLQRWL
GHSLVWLIAAGLCANLWNGFVAERTSLATLGQKARSLAALLARNDLSADPERAPMVLDHA
KDLLHDATRLATDADDTFRFATARLETIASGSRHVYEALSEQAVLPHIVRRMEDAIVSAV
ATGDAQAAYDALRVYLMLHDRERFNSNDIRMWVLDDWARHDSAAAFGGRAAVIGHVQRLF
SEGHVVHSPLSRNDALIRQARVFLDRSDPVERLYRRAKAAMRNDAPDEFSLLRMVGTQAG
MVFTRVSGAPLSGGVPGIFTREGYQAVFSKRLPEFLRAASDDDAWVIGRRASGYPRRNSA
GTLSAPNQDDDALLAAVTRRYLLEYAQQWDAFLGDIRIVSRTSLAFNLKILRTLAAPDSP
LTRLVRAAVIETTLTQPMAKPDGPFLAKATDTINQTAETILGPRASEEAEGEWVDRHFAA
LREVVTGHADTRPDTQRVGTSSGRTSLDGIADLLNDYYAALAIADNALLNNSMPPESEHA
AKLKMMADTMPAPLRAVLHQLAVDGSRGINQGIGQLLSRQMQAAVGDTCRTTIEGNYPFS
PDSSRDVGIDDFTRMFAHGGVIDDFFMRTLAPFVDTAAKPWRYRTLPGATEPVQGPDLAP
FEHATAIRDIFFSDVDRKRPSWKVDIRVPELDPTIMSLSLDIDGQTTRYQHGPVAPFTVT
WPGPRGGVYARLVASPSIRPDTSTIAADGPWALMRLLRKGRVIETATPGRTRVVFSFDGR
EAALDVASAGSVANPLTTDVLTTFRCPGTMPVFDLPDSGPPVGLPREPLPVVSDPMRERI
SMSSVTSSLTNQR
NT seq 4002 nt   +upstreamnt  +downstreamnt
atgaagaagattctctcgtttctaagttcgcgtcatctgagggcggtcgtgatggtgatc
gctgccgtcgtcgcgatctggtttgcaggaccgctgctgagtttcggtggactgaatccg
cttgcgtcgatcgacattcggctgacgttgatcgcgttggtactcgccgcatgggtcctg
tggctgatcgactggacgacgagcatcgtgaccgtcgtgctgctcagtctcgcgatctgg
catgcgtttccgctggtgacgctgtctggcgaaccactgtttgcttcggtaacgttccgc
attctggcaatgaccggtgttgtggccgtttatgccgccgtcatgtcgatccgatggtgg
aggcaaatgcgccggcatccgggccggctcagacgattgcttcgactcggcaagcgcggc
gcacggccgctggctgcgtcgcgcttggcggaaatcgaagacatggcccgcgcaacgatc
gcgcagttgaaagccggccgcggggccggcggaaggctggcccggctgtttcgaggcgca
gcacatctctacgatgtgccttggtatgtcgtgctgggcccgaggggttcgggcaagacc
gcgatgctgctcaactcgggcttgccctttccgctcgacgcacgtcttcagcattcactt
gcacccaatgacgcgcgcgccttgccgggatggcggctgaccaatgaggcggtgctgatc
gatacggcgggccactacgtgcaacacggcacgtcgcgctactcgctgccgctggcgtcg
tcgcacaggccgagcgacgggaagccgaaaaatcagccgcccgacatggccgccattcgc
aggcagtccgatgccgcggagtggcagggatttcttcggctgcttcgccgtatccggcct
cgcctgccgctgaatggcgtgctgttgacgatcgacgtcgctgcgttggcgcatgcgaat
cccgccgcacatacgaccgagagccgcgcattgcgggctcgcgtcgaggagatgcaggcc
gaattcggcaccgggtttcccgtctggctggttgtcacgaaaatggatcggcttccgggt
ttcgccgactattttgcttcgctcggggaagcggagcgtgcgcagatttggggtgtgacg
ctcgggtccgacctgcaggcgcggatgaacgatgcgctcaggacaggattgaatctgctt
gccacgcgtctggccgatggcgtgaccagtctgcttcgcaacgaaaccgatatggaccgc
cggcgccgtcttgcgacgttgcccgaatcggttgcggcactggtgaacccgttgggcgac
ctgatcgaacacgtgttcgccagggaccacaacggtggcccgaccggaccgcgtgcgatg
ttccgaggcgtttatctgacgagtgcatcccagggtgatcacccggtcgctgcggaacgt
cgaacgctattgcgacgcatgatcgacgcatccggcacaacacgaaggaaccctcgaccg
acgcctggcgaaaccagctacttcctgcgtgatttgtggtccgggatcgtgtttcgcgaa
gggcatctcgcgatcccgaaccggaatcgtgagcatcgggcacgactgcagcggtggctg
ggacactcgctcgtgtggctgattgccgccggattgtgcgcgaatctttggaacggcttc
gttgctgagcgaacatcccttgcaacgctggggcaaaaggcacggtcactcgccgcatta
ctcgcacgaaacgacctttccgccgatccggaacgtgcgccgatggtattggaccatgcg
aaagatctgctgcatgacgcgacgcgtctcgccaccgatgccgacgacacgtttcgtttt
gcaaccgcccgcctcgagacgatcgcgtccggcagccgccacgtgtacgaggccctgtcg
gaacaggccgtgctgccgcacatcgtccgccgcatggaggacgcgatcgtcagcgccgtg
gcgacgggcgatgcccaagccgcttacgacgcgttgcgcgtgtacctgatgctccacgac
cgagaacggttcaactcgaacgacatcaggatgtgggtgctggacgactgggcgcggcac
gacagcgcggcggcattcggcggacgcgccgctgtgatcggccacgtccagcggctgttt
tccgagggacatgtcgtgcactcgccactgtcccgtaacgatgccttgattcggcaggca
cgcgtctttctcgaccgaagcgacccggtcgaacgtctttaccggcgcgccaaggcggcc
atgcggaacgacgcgccggatgaattttcgctgctgcggatggttggaacgcaggccggc
atggtgtttacgcgcgtcagcggagcgcccttatcgggcggcgtgccgggaatctttacg
cgagaaggttatcaggcggtgttcagcaaacgcttgccggaattccttcgggcggcaagc
gacgatgacgcctgggtaattggacgtcgagcatcgggctatcctcgcaggaattccgct
ggcacgttgagcgcaccgaaccaggacgacgacgcgctgttggcagcggttacgcgtcgg
tacctgctcgagtacgcgcaacaatgggacgcgtttctcggcgacatccgtatcgtgagt
cgaacgagtctcgctttcaacctcaagatactgcgaaccctcgctgcgcccgattcaccg
ctgactcgtctggtccgggcggcggtaatcgaaacgacgctgacacagccaatggcgaag
ccggacggccccttcctcgcaaaagcaaccgacacgatcaaccagacagccgagacgata
ctggggcctcgtgcatcggaagaggctgaaggcgagtgggtcgatcgtcatttcgcggcg
ttgcgcgaggtggtgacgggccatgccgatacacgaccggatacgcagcgggtcggaacg
tcgtcgggaagaacgagcctggacggaatcgccgatctgttgaacgactactacgcagcg
ctcgcgattgccgacaatgcgctgctgaacaacagcatgccgccggaaagcgagcacgcc
gcgaagctgaagatgatggccgatacgatgcccgcgccattgcgggcagtgctgcatcaa
ctcgccgtcgacggctcgcgcgggatcaatcagggcatcggccagttgctgtcgcgccag
atgcaggccgcagtcggggatacctgtcgaacgacgatcgaaggcaactacccgttctcg
cccgatagcagccgcgacgtcggcatcgacgatttcacgcggatgtttgcgcacgggggc
gtgatcgacgacttcttcatgagaacgcttgcgccgttcgtcgataccgctgcgaaaccg
tggcgctaccggaccctgcccggcgcgaccgaacccgttcaagggccggacctcgcgcca
ttcgagcatgccacggcaatccgcgacattttcttcagcgatgttgaccgcaagcggccg
agttggaaggtcgacatccgcgtccctgaactcgatccgacgatcatgagcctgtcgctc
gacatcgacggacagacgacgcgttatcaacatggcccggtcgcgccttttacggtgacc
tggccgggaccgcgtggtggcgtctacgcccggctcgtcgcgagcccgagcatccggccg
gacacatcgacaatcgcagcggacggaccatgggcgctaatgcgcttgcttcggaagggg
cgcgtaatcgaaacggccacaccgggccgcacgcgcgtggtgttcagcttcgacggtcgc
gaagcggcgctcgacgtcgcgagcgcgggaagtgttgccaatccgttgacgaccgatgtg
ctgacgacgtttcgctgtccgggcacgatgcctgtgttcgatctaccggatagtggtcct
ccggtggggctgccgcgcgagccgcttccggtggtctcggatccgatgcgggagcgcatt
tcgatgtcatccgtgacgtcatcgttgacgaaccaaaggtaa

DBGET integrated database retrieval system