KEGG   Burkholderia pseudomultivorans: WS57_00140
Entry
WS57_00140        CDS       T04870                                 

Definition
(GenBank) RND transporter
  KO
K07003  uncharacterized protein
Organism
bpsl  Burkholderia pseudomultivorans
Brite
KEGG Orthology (KO) [BR:bpsl00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    WS57_00140
SSDB
Motif
Pfam: MMPL
Other DBs
NCBI-ProteinID: AOI87318
LinkDB
Position
2:complement(37655..40288)
AA seq 877 aa
MVTSLIVRLVAWSVRRPVWVVVLSLVIAAFSGVYVAHHFKINTDISKLVDAEPQWAALGR
AVDRAFPQRNGTILAVVEAPAPEFANAAAQALTESLQKQTDAGRIGQVAEPGGGPFFEHN
GLLFLSPQEVADTTSQLASARPLVNELAKNPSLTGLATTLSTTLGQPLLTGQVKLPAMAK
LLARSAATVDDVLAGRPAAFSWRALVDNDAARQPARAFVTVQPVVNYGALKAGAETSQVI
RDAARALDLEKRYGAVVRLTGEQPLADDEFASVEDGAVLNGVLTLLVVLCILWLALRSKR
MIGSVLVTLFVGLVVTAALGLAMVGSLNMISVAFMVLFVGLGVDFSIQYGVKYREERFRD
ARIDHALIGAAHSMGMPLALATTAVAASFFSFIPTAYRGVSELGLIAGVGMFVALLTTLT
LLPALLRLFAPPGESKTPGFPWLAPVDDYLDRHRKPILIGTLAVVIGALPLLTFLRFDFN
PLHLKDPHSESMATLLALKDSPEAAVNDVTLLAPSLAEADAAAKRLDALPEVGRTTTLST
FIPADQPQKRAAIAAAASALLPALTQPAAPPATDAQRVAALKRVSDLLSYAAEDHPGPGA
AAAQHLSQSLAKLAAADSATRDRAERAFSDTLRIALNQLAALLQPQDITRDSLPPQLVRD
WIAPDGHALVQISPKVPKGVDPNDDTMLRRFATAVKTAEPGAIGGPISILHSADTIISAF
LHAALWSIISITILLWITLRRFGDVLRTLVPLLVSGIVTLEMCVVLGMSLNFANIIALPL
MLGVGVAFKVYFVMAWRAGQTGLLHSSLTHAVLFSAATTATAFGSLWLSHHPGTSSMGKL
LALALTCTLIGAVVFQPVLMGKPRVKRAKNQSQGINE
NT seq 2634 nt   +upstreamnt  +downstreamnt
atggtgacatctctcatcgtccgactcgtcgcgtggtcggtgcgacgccccgtctgggtc
gtcgtgctgtcgctcgtgatcgccgcgttcagcggcgtctacgttgcgcatcatttcaag
atcaacaccgacatcagcaagctcgtcgacgcagagccgcagtgggccgcgctcggccgc
gcggtcgaccgtgcattcccgcaacgcaacggcacgatcctcgccgtcgtcgaggcgccc
gcacccgaattcgcgaacgccgccgcgcaggcgctgaccgagtcgctgcagaagcagacc
gacgccggccgcatcggccaggtcgccgagccgggcggcggtccgttcttcgagcacaac
ggcctgctgttcctctcgccgcaggaagtcgccgacaccacgtcgcaactcgccagcgcc
cgcccgctcgtcaacgagctcgcgaagaacccgagcctcacggggctcgcgacgacgctg
tcgacgacgctcggccagccgctgctgaccggccaggtgaaactgccggcgatggccaag
ctgctcgcgcgcagcgccgcgacggtcgacgacgtgctggccggccggcccgccgcattc
tcgtggcgcgcgctggtcgacaacgatgccgcgcggcagcccgcgcgcgcgttcgtcacc
gtgcagccggtcgtcaactacggcgcgctgaaggccggcgcggaaacgagccaggtgatc
cgcgacgcggcccgcgcgctcgacctcgagaagcgctacggcgcggtcgtgcgcctgacc
ggcgaacagccgctcgccgacgacgagttcgcgtcggtcgaggacggcgcggtgctcaac
ggcgtgctcacgctgctcgtcgtgctgtgcatcctgtggctcgcgctgcgctcgaagcgg
atgatcggctcggtgctcgtcacgctgttcgtcggcctcgtcgtcaccgcggcgctgggc
ctcgcgatggtcggctcgctgaacatgatttcggtcgcgttcatggtgctgttcgtcggc
ctcggcgtcgacttttcgatccagtacggcgtcaagtatcgcgaggaacgctttcgcgac
gcgcgcatcgatcacgcgctgatcggcgccgcgcactcgatgggcatgccgctcgcgctc
gcgaccaccgccgtcgcggcgagcttcttctcgttcatcccgaccgcgtatcgcggcgtg
tccgagctcggcctgatcgccggcgtcggcatgttcgtcgcgctgctgaccacgctcacg
ctgctgccggcgctgctgcgcctgttcgcgccgccgggcgaatcgaagacgccgggcttc
ccttggctcgcgccggtcgacgactacctcgaccgtcaccgcaagccgatcctgatcggc
acgctcgcggtcgtgatcggcgcgttgccgctgctcacgttcctgcgcttcgacttcaac
ccgttgcacctgaaggatccgcacagcgaatcgatggcgacgctgctcgcgctgaaggat
tcgcccgaggcggccgtgaacgacgtcacgctgctcgcgccgtcgctcgcggaggccgac
gcggccgcgaaacgcctcgacgcgctgcccgaagtcggccgcacgacgacgctgtcgacc
ttcattccggccgaccagccgcaaaagcgcgcggcgatcgccgcggccgcgagcgcgctg
ctgcccgcgctgacccagccggccgcgccgccggccaccgacgcgcagcgcgtggccgcg
ctcaagcgtgtgtcggacctgctgagctacgcggccgaggaccatcccggcccgggcgcg
gcggctgcgcagcacctgtcgcaatcgctcgcgaagctcgccgccgccgacagcgcgacg
cgcgatcgcgccgagcgcgcgttctccgacacgctgcgcatcgcgctgaaccagcttgcg
gcgctgctgcagccgcaggacatcacgcgcgattcgctgccgccgcagctcgtgcgcgac
tggatcgcaccggacggccatgcgctcgtgcagatttcgccgaaggtgccgaagggcgtc
gacccgaacgacgacacgatgctgcgccgtttcgcgacggccgtgaaaaccgccgagccg
ggcgcgatcggcgggccgatctcgatcctgcactcggccgacacgatcatcagcgcgttc
ctgcatgcagcgctgtggtcgatcatttcgatcacgatcctgctatggatcacgctgcgc
cgcttcggcgacgtgctgcgcacgctggtgccgctgctcgtgtcgggcatcgtgacgctc
gagatgtgcgtggtgctcggcatgtcgctgaacttcgcgaacatcatcgcgctgccgctg
atgctcggcgtcggcgtcgcgttcaaggtctatttcgtgatggcgtggcgcgcgggacaa
accgggctgctgcattcgagcctcacgcacgcggtgctgttcagcgccgcgacgacggcc
accgcattcggcagcctgtggctgtcgcatcatccgggcacctccagcatgggcaagctg
ctggcgctggcgctgacctgcacgctgatcggcgccgtggtattccagcccgttctgatg
ggcaaaccgcgcgtgaagcgcgcgaagaaccaatcgcaaggaatcaatgaataa

DBGET integrated database retrieval system