KEGG   Burkholderia pseudomultivorans: WS57_00145
Entry
WS57_00145        CDS       T04870                                 

Definition
(GenBank) ABC transporter
  KO
K07323  phospholipid transport system substrate-binding protein
Organism
bpsl  Burkholderia pseudomultivorans
Pathway
bpsl02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bpsl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    WS57_00145
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpsl02000]
    WS57_00145
Transporters [BR:bpsl02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Phospholipid transporter
    WS57_00145
SSDB
Motif
Pfam: MlaC LPAM_1
Other DBs
NCBI-ProteinID: AOI87319
UniProt: A0A132EPG9
LinkDB
Position
2:40605..41201
AA seq 198 aa
MKRHLFAFVAAAAVSVSAFAQSAPVDVVRNAVEGTVNAMKADPAARGGDMAKVTQVVEQR
FLPATNFERTTRIAVGDAWKQATPQQQQELYKQFRLLMTRTYAASLAQLGNQDAKFSFKA
GGASGADALVQSTVTTPGDSQSVGYRLGKVGSDWKIYDIDMSGAWLIQVYQGQFKSQLAS
GGIDGLIAYLQKHNARTN
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaaacgtcatctgtttgctttcgtcgcggcggccgccgtgtcggtttccgctttcgcg
cagagcgcgccggtcgacgtcgtccgcaatgcggtcgagggcaccgtcaatgcgatgaag
gccgatccggccgcgcgcggcggcgacatggcgaaggtcacgcaggtcgtcgagcagcgc
ttcctgcccgcgacgaacttcgagcgcacgacccgcatcgcggtcggcgacgcgtggaag
caggcgacgccgcaacagcagcaggagctgtacaagcagttcaggttgctgatgacgcgc
acctacgcggcatcgctcgcccagctcggcaaccaggacgcgaagttctcgttcaaggcc
ggcggcgcgtcgggcgcggacgcgctcgtgcagtcgacggtgacgacgccgggcgacagc
cagtcggtcggctatcgtctgggcaaggttggcagcgactggaagatctacgacatcgac
atgtccggtgcgtggctgatccaggtctatcagggtcagttcaagagccagcttgcgtcg
ggcgggatcgacggcctgatcgcctacctgcagaagcacaacgcacggacgaactga

DBGET integrated database retrieval system