KEGG   Burkholderia pseudomultivorans: WS57_00160
Entry
WS57_00160        CDS       T04870                                 

Definition
(GenBank) LuxR family transcriptional regulator
  KO
K07684  two-component system, NarL family, nitrate/nitrite response regulator NarL
Organism
bpsl  Burkholderia pseudomultivorans
Pathway
bpsl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpsl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    WS57_00160
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bpsl02022]
    WS57_00160
Two-component system [BR:bpsl02022]
 NarL family
  NarX-NarL (nitrate respiration)
   WS57_00160
SSDB
Motif
Pfam: Response_reg GerE Sigma70_r4_2 HTH_29 HTH_24 HTH_23 HTH_20 Sigma70_r4 HTH_40 HTH_11 HTH_38 HTH_28 HTH_Tnp_ISL3 MarR_2 HTH_36
Other DBs
NCBI-ProteinID: AOI87322
LinkDB
Position
2:complement(43662..44306)
AA seq 214 aa
MSAPDTARTAARLLLVDDHPLVRDGLRMRLEAADLSVVGEAGNADEALALAASLEPDLAL
MDVGMNGMNGITLAGVFHDRFPAIRVLMLSMHDNVEYVTQAVRAGASGYLLKDSPASEIV
RAIGSVLAGQTFFSEGLAARMIQASAAASPLDRLTPRERDILDALAEGLSSKQIAQQTGL
SVRTVETHRLNLKRKLEIEGQAELIKFAVEHRRR
NT seq 645 nt   +upstreamnt  +downstreamnt
atgagcgcccccgacacggcccggaccgccgcccgcctgctgctcgtcgacgatcatccg
ctggtccgcgacgggctgcggatgcggctcgaagcggccgacctgagcgtggtcggcgag
gccggcaacgccgacgaggcgctcgcgctggccgcgtcgctcgaaccggatctcgcgctg
atggacgtcgggatgaacggcatgaacggaatcacgctcgccggcgtgttccacgaccgg
tttcccgcgatccgcgtgctgatgctgtcgatgcacgacaacgtcgaatacgtgacgcaa
gccgtgcgcgccggggcgagcggctatctgctgaaggattcgccggccagcgagatcgtc
cgcgcgatcggctcggtgctggccggccagaccttcttcagcgaagggctggccgcgcgg
atgatccaggcgagcgcggccgcgtcgccgctcgaccgcctgacgccgcgcgaacgcgac
atcctcgatgcgctggccgaggggctgtcgagcaagcagatcgcgcagcagacggggctg
tcggtgcgcacggtcgagacgcaccggctcaacctgaagcgcaagctcgagatcgagggg
caggccgagctgatcaagttcgcggtcgagcatcggcggcgctag

DBGET integrated database retrieval system