KEGG   Burkholderia pseudomultivorans: WS57_00170
Entry
WS57_00170        CDS       T04870                                 

Definition
(GenBank) diguanylate cyclase
Organism
bpsl  Burkholderia pseudomultivorans
SSDB
Motif
Pfam: GGDEF dCache_1
Other DBs
NCBI-ProteinID: AOI89625
LinkDB
Position
2:complement(45940..47505)
AA seq 521 aa
MAETDYTMLSESGPTSRVAAHLRRLLLPHLIFYSALLIGLLLLLLCAIVLYEGRIDARDR
ARTTQQNIALMASWDIERNIEIYSLSLQAVVEGENDPAVVALPMPLRRQVLFDRATTARY
LGGIYVLGANGDIAVDGKSDVPRKGNFANEPYFAVHRDHPDVGLYVSDPYRSRLRGGSPS
IALSRRITRPDGSFGGVAVMSIRLEYFQNLFSRLSLGDRGSMSLIGTDGVMVMRQPYDPK
IVGRDISKASTFRQFMRANEGSFFDTASIDGVRRLYVFRHLANLPLIIMVAQAESNIYAA
WYDRAIPIGSAMAVLALGFVALSLLLDVQLRKRHRAETELQALARTDGLTGLDNRRMLDV
TLAREWRRAARSQHALSLLFVDVDHFKRYNDTQGHQAGDDALAAVGHCIVGCLRRPADYA
ARYGGEEFVVILPDIDTGGAVAIAETIRTSILDLGIRHDASSFGCLTASIGVTTCYPERD
DSIQAALKLADDALYRAKEAGRNRVVVQSVHTSVRLEPRRA
NT seq 1566 nt   +upstreamnt  +downstreamnt
atggcagaaaccgactacacgatgctcagcgaatccggcccgacaagccgcgtcgccgcg
catctgcgccggctgctgctgccccacctgatcttctattccgcgctgctgatcgggctg
ctcctgctgctgctgtgcgcgatcgtgctctacgagggccgcatcgacgcgcgcgaccgc
gcgcgcaccacgcagcagaatatcgcgctgatggcgtcgtgggacatcgagcgcaacatc
gagatctattcgctgtcgctgcaggccgtggtcgagggcgagaacgatcccgcggtcgtc
gcgctgccgatgccgctgcgccgccaggtgctgttcgaccgcgcgacgacggcccgctac
ctcggcggcatctacgtgctcggcgcgaacggcgacatcgcggtcgacggcaagagcgac
gtgccgcgcaagggcaatttcgcgaacgagccgtacttcgccgtgcaccgcgatcatccc
gacgtcggcctgtacgtcagcgatccgtaccgctcgcggctgcgcggcggctcgccgagc
atcgcgctcagccggcgcatcacgcggcccgacggctcgttcggcggcgtcgccgtgatg
tcgatccggctcgaatatttccagaacctgttctcgcggctgtcgctcggcgatcgcggc
tcgatgtcgctgatcggcacggacggcgtgatggtcatgcgccagccttacgacccgaag
atcgtcggccgcgacatcagcaaggcgagcacgttccggcagttcatgcgcgcgaacgaa
ggcagcttcttcgacaccgcgtcgatcgacggcgtgcggcgcctctacgtgttccggcac
ctggcgaacctgccgctgatcatcatggtcgcccaagccgaatcgaacatctatgccgcg
tggtacgaccgcgcgattccgatcggctcggcgatggccgtgctcgcgctgggcttcgtc
gcgctgtcgctgctgctcgacgtgcagctgcgcaagcgccatcgcgcggaaaccgagctg
caggcgctcgcgcgcaccgacgggctcaccggcctcgacaaccgccgcatgctcgacgtc
acgctcgcgcgcgaatggcgccgcgccgcgcgctcgcagcatgcgctgtcgctgctgttc
gtcgacgtcgaccacttcaagcgctacaacgacacgcagggccaccaggccggcgacgac
gcgctggccgcggtcggccattgcatcgtcggctgcctgcgccgtccggccgactacgcg
gcccgctacggcggcgaggagttcgtcgtgatcctgcccgacatcgacacgggcggcgcg
gtggcgatcgccgagacgatccgcacgagcatcctcgacctcggcatccggcacgacgcc
agctcgttcggctgcctgaccgcgagcatcggcgtgacgacctgctaccccgagcgggac
gacagcatccaggccgcgctgaagctcgccgacgacgcgctgtaccgcgcgaaggaagcc
gggcgcaaccgcgtcgtcgtgcagagcgtgcatacctcggtgcggctcgagccgcgccgc
gcttga

DBGET integrated database retrieval system