KEGG   Burkholderia pseudomultivorans: WS57_00175
Entry
WS57_00175        CDS       T04870                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bpsl  Burkholderia pseudomultivorans
Pathway
bpsl00620  Pyruvate metabolism
bpsl00630  Glyoxylate and dicarboxylate metabolism
bpsl01100  Metabolic pathways
bpsl01110  Biosynthesis of secondary metabolites
bpsl01120  Microbial metabolism in diverse environments
bpsl01200  Carbon metabolism
Module
bpsl_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bpsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    WS57_00175
   00630 Glyoxylate and dicarboxylate metabolism
    WS57_00175
Enzymes [BR:bpsl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     WS57_00175
SSDB
Motif
Pfam: Malate_synthase
Other DBs
NCBI-ProteinID: AOI87324
LinkDB
Position
2:complement(47947..50121)
AA seq 724 aa
MIDQEGLQVAPALSQFIENEALPGTGIDKTAFWRGFSALVHDLAPRNRELLAERDRLQQE
LDTWHRAHPGPVRDLAAYRAFLEGIGYLVPTPSNVAAATANVDSEIATQAGPQLVVPLSN
ARYALNAANARWGSLYDALYGTDALPEDGGAERTATYNPTRGQRVIDYARNVLDNAAPLA
GASHRDALRYRVEDGQLAVETGKGVVHLAQPAQFVGYQGAAGAPSAILLKHNGLHIEIQI
DASTPIGRADLANVKDVVLEAAVSTIIDCEDSVAAVDADDKVQLYRNWLGLMQGTLVEEV
AKGGKTFTRRLNADREYTTPAGGTLTLHGRSLLFVRNVGHLMTNGAVLDRDGNEIPEGIL
DGVVTTLCALHDLKAKRNSRTGSIYIVKPKMHGPVEVAFADTLFARIEDLYELPRNTLKM
GIMDEERRTSVNLAACIAAAASRVAFINTGFLDRTGDEMHTAMEAGPMIRKGDMKSSAWI
TAYERNNVLAGLSAGLRGRAQIGKGMWAMPDLMHAMLEQKIAHPRAGANTAWVPSPTAAT
LHALHYHLVDVQAVQQELEKIPYASERDALLEGLLTVPVVEHAEWSDAEILSEVENNAQG
ILGYVVRWVEQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLRHGVITEAFVLDVFKR
MARVVDQQNAGDPNYRPMAPGYDQSTAFKAACALALQGTSQPSGYTEPLLHRFRLAFKAQ
QQGA
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgatcgaccaagaaggactgcaagtcgcgcccgcgctgagccagttcatcgaaaacgaa
gcgctgccgggcaccggcatcgacaagactgcgttctggcgcggtttctcggcgctggtg
cacgacctcgcgccgcgcaaccgcgaactgctcgccgaacgcgaccgcctgcaacaggaa
ctcgacacgtggcaccgcgcgcaccccggcccggtgcgcgaccttgccgcgtatcgcgcg
ttcctcgaaggcatcggctatctcgtgccgacgccgtcgaacgtcgcggcagccaccgcg
aacgtcgacagcgaaatcgcgacgcaggccggcccgcagctcgtcgtgccgctgtcgaac
gcgcgctatgcgctgaacgccgcgaatgcgcgctggggcagcctgtacgacgcgctgtac
ggcaccgacgcgctgccggaagacggcggcgccgaacgcaccgcgacctacaacccgacg
cgcggccagcgcgtgatcgactatgcgcgcaacgtgctcgacaacgcggcgccgctcgcc
ggcgcatcgcaccgcgacgcgctgcgctaccgcgtagaggacggccagctcgccgtcgag
accggcaagggcgtcgtgcacctcgcgcagccggcgcagttcgtcggctaccagggcgcg
gccggggcgccgtcggcgatcctgctcaagcacaacggcctgcacatcgagatccagatc
gacgcgtcgacgccgatcggccgtgccgatctcgcgaacgtgaaggacgtcgtgctcgaa
gcggcggtcagcacgatcatcgactgcgaggactcggtcgcggccgtcgacgccgacgac
aaggtccagctctaccgcaactggctcggcctgatgcagggcacgctggtcgaggaagtc
gcgaagggcggcaagaccttcacgcgccgcctgaacgccgaccgcgaatacaccacgccc
gccggcggcacgctgacgctgcacggccgctcgctgctgttcgtgcgcaacgtcggccac
ctgatgaccaacggcgcggtgctcgaccgcgacggcaacgagattccggaagggatcctc
gacggcgtcgtcacgacgctgtgcgcgctgcacgacctgaaggcgaagcgcaactcgcgc
accggctcgatctacatcgtgaagccgaagatgcacggcccggtcgaggtcgcgttcgcc
gatacgctgttcgcgcgcatcgaagatctgtacgagctgccgcgcaacacgctgaagatg
ggcatcatggacgaggagcgccgcaccagcgtgaacctcgccgcgtgcatcgcggccgcg
gcttcgcgcgtcgcgttcatcaacacgggcttcctcgaccgtaccggcgacgagatgcac
accgcgatggaagcgggcccgatgatccgcaagggcgacatgaagtcgtcggcgtggatc
accgcgtacgagcgcaacaacgtgctcgcgggcctgtcggccggcctgcgcggccgcgcg
cagatcggcaagggcatgtgggcgatgccggacctgatgcacgcgatgctcgaacagaag
atcgcgcatccgcgcgccggcgcgaacaccgcatgggtgccgtcgccgaccgccgcgacg
ctgcacgcgctgcactaccatctcgtcgacgtgcaggccgtccagcaggaactcgagaag
attccgtatgcgagcgagcgcgacgcgctgctcgaaggcctgctgaccgtgccggtcgtc
gagcacgccgaatggagcgacgccgagatcctgagcgaagtcgagaacaacgcgcagggc
atcctcggctacgtcgtacgctgggtcgaacagggcgtcggctgctcgaaggtgcccgac
atccacgacgtcggcctgatggaagaccgcgcgacgctgcgcatctcgagccagcacatc
gcgaactggctgcgtcacggcgtgatcaccgaggcgttcgtgctcgacgtgttcaagcgg
atggcgcgcgtcgtcgaccagcagaacgcgggcgacccgaactatcgcccgatggcgccg
ggctacgaccagtcgaccgcgttcaaggccgcgtgtgcgctcgcactgcagggtacgtcg
cagccgagcggttataccgagccgctgctgcaccgcttccggctcgcgttcaaggcgcag
cagcagggcgcgtaa

DBGET integrated database retrieval system