KEGG   Burkholderia pseudomultivorans: WS57_01295Help
Entry
WS57_01295        CDS       T04870                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bpsl  Burkholderia pseudomultivorans
Pathway
bpsl00250  Alanine, aspartate and glutamate metabolism
bpsl00410  beta-Alanine metabolism
bpsl00640  Propanoate metabolism
bpsl00650  Butanoate metabolism
bpsl01100  Metabolic pathways
bpsl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    WS57_01295
   00650 Butanoate metabolism
    WS57_01295
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    WS57_01295
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    WS57_01295
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bpsl01007]
    WS57_01295
Enzymes [BR:bpsl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     WS57_01295
Amino acid related enzymes [BR:bpsl01007]
 Aminotransferase (transaminase)
  Class III
   WS57_01295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AOI87531
LinkDB All DBs
Position
2:complement(296285..297574)
Genome map
AA seq 429 aa AA seqDB search
MTVKNADLLARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRH
PKIVKAISEQLNNFTHTAYQIVPYASYVELAEKINERAPGDFPKKTAFFTTGAEAVENAI
KIARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNAVHGVT
TADSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVRALRKICNEHGILLIAD
EVQTGFARTGKLFAMQHYDVLADLITMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYA
GNPLAVASAHAVLDIIDEEKLCERATQLGDVLKAKLNALQADVPQIADVRGPGAMIAVEF
MKPGTGEPDAEFTKRVQARALERGLLLLVCGVYSNVVRFLFPLTIPQAVFDEALAILEEV
LKETVGVPA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgaagaatgccgacctgctggcccgcaagaacgccgccaccccgcgcggcgtc
ggagtgatgtgcgacttctacgccgcccgcgccgagaacgcggagctgtgggacgtcgaa
ggccgccgcttcatcgatttcgccgccggcatcgcggtgttgaacaccggccaccgccac
ccgaagatcgtcaaggcgatctcggagcaactgaacaacttcacgcacaccgcctaccag
atcgtcccgtacgcgtcgtacgtcgagctggccgagaagatcaacgaacgcgcgccgggc
gacttcccgaaaaagaccgcgttcttcacgaccggcgccgaagccgtcgaaaacgcgatc
aagatcgcgcgcgcggcaaccggccgtccgggcgtcatcgcgttctcgggcggcttccac
ggccgcacgatgatgggcatggcgctgaccggcaaggtcgcgccgtacaagctgaacttc
ggcccgttcccgggcgacgtgttccacgcgccgtacccgaacgccgtgcacggcgtgacg
accgccgactcgatcaaggcgatcgagatgctgttcaaggccgacatcgatccgaagcgc
gtcgccgcgatcatcttcgaaccggtgcagggcgaaggcggcttcaacccggcgccggcc
gagttcgtgcgtgcgctgcgcaagatctgtaacgagcacggcatcctgctgatcgccgac
gaagtgcagacgggcttcgcgcgtaccggcaagctgttcgcgatgcagcactacgacgtg
ctggccgacctgatcacgatggcgaagagcctcgcgggcggcatgccgctgtcgggcgtc
gtcggccgtgcggacgtgatggacgcggccgcgcccggcggtctcggcggcacctacgcg
ggcaacccgctggcggtcgcgtcggcgcacgcggtgctcgacatcatcgacgaagagaag
ctgtgcgagcgcgcgacgcagctcggcgacgtgctgaaggcgaagctgaacgcgctgcag
gccgacgtgccgcagatcgccgacgtgcgcggcccgggcgcgatgatcgcggtcgagttc
atgaagccgggcaccggcgagccggacgccgaattcacgaagcgcgtgcaggcgcgtgcg
ctcgagcgcggcctgctgctgctggtctgcggcgtgtactcgaacgtcgtgcgcttcctg
ttcccgctgacgatcccgcaagccgtgttcgacgaagcgctcgcgatcctcgaggaagtg
ctgaaggaaacggtcggcgtgccggcctga

DBGET integrated database retrieval system