KEGG   Burkholderia pseudomultivorans: WS57_06640Help
Entry
WS57_06640        CDS       T04870                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
bpsl  Burkholderia pseudomultivorans
Pathway
bpsl02020  Two-component system
bpsl02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bpsl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    WS57_06640
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    WS57_06640
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bpsl02035]
    WS57_06640
Bacterial motility proteins [BR:bpsl02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    WS57_06640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal dCache_1 HAMP GAPES1 DUF948 SF-assemblin Laminin_II V_ATPase_I
Motif
Other DBs
NCBI-ProteinID: AOI88495
LinkDB All DBs
Position
2:complement(1579176..1580975)
Genome map
AA seq 599 aa AA seqDB search
MFSSIRARILAACVAIVVFALVATTLINYFIAHSYNDDAIDRNLTSVASGHVVGIADWVA
TKSRMVASLQDAALSPDPLPVFKQMAAAGGFTNVYAGYADKVFHFSDPTGIPPDYDPTGR
PWYRQAAQAGKPVVTPPYVDAGTGNLVVTFAVPILRDGALKGVVAADVAMDSVIANVKSI
HPTPASFGMLIDSSGHVVAHPDAKLTLKPVADVSPELGGISPASLAGASAPVEVQVGGDA
KLVRAQPVPGTDWYAVVALDKSDATAGMRSLLTASLITMIVIVAVASLIVGAITATAFRR
LSQVRQAMAEIGSGAGDLTQRLPAEGRDEVADIARSFNSFVDKLNDVMRQIRDASESVRT
AANEIAAGNVDLSSRTESAAASLEETAASMEEITATVGQSAAAAGQADERAAAASRIASH
GGAVVSEVVATMAKIEEASGRIGDIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVV
AQEVRSLAQRSAQAAREVKVLVESTVESVSAGSGQVRQAGETMREIVSNVTNVTTIISEI
THAANEQTRGIQEVNRAVTQLDEMVQQNAALVEQSTAAASALQTQANALASTVGQFKVA
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgttctcgtccatccgcgcacgcatcctcgccgcgtgcgttgccatcgtcgtctttgcg
ctcgtcgccaccacgctgatcaactatttcatcgcgcactcgtacaacgacgacgcgatc
gaccggaacctgacttcggtcgcgagcggccacgtcgtcgggatcgcggactgggtcgcg
accaagagccggatggtcgcgtcgctgcaggacgccgcgctgtcgcccgatccgctgccg
gtgttcaagcagatggcggcggcgggcggcttcacgaacgtctatgccggctatgcggac
aaggtgttccacttctccgacccgaccggcattccgcccgactacgatccgaccggccgc
ccgtggtaccggcaggccgcgcaggccggcaagccggtggtcacgccgccgtacgtcgat
gccggcaccggcaacctggtcgtcacgttcgcggtgccgatcctgcgcgacggtgcgctg
aagggcgtggtggccgcggacgtcgcgatggacagcgtgatcgcgaacgtgaagtcgatc
caccccacgccggccagcttcgggatgctgatcgacagcagcggccacgtggtcgcgcac
ccggatgccaaactcacgctgaagccggtcgccgacgtgtcgccggagctcggcggcatc
agccccgcgtcgctggcgggcgcgagcgcgccggtcgaggtgcaggtcggcggcgacgcg
aagctggtgcgcgcgcagccggtgccgggcaccgactggtacgcggtggtcgcgctcgac
aagtcagatgcgacggccgggatgcgttcgctgctgaccgcgtcgctgatcacgatgatc
gtgatcgtcgccgtcgcgtcgctgatcgtcggcgcgatcacggcgaccgcgttccgccgc
ctgtcgcaggtgcgccaggcaatggccgagatcggctcgggcgccggcgatctcacgcag
cgcctgccggccgaaggccgcgacgaagtggccgacatcgcacgctcgttcaacagcttt
gtcgacaagctgaacgacgtgatgcgccagatccgcgatgcgagcgaatcggtgcgcacg
gccgcgaacgaaatcgcggccggcaacgtcgacctgtcgtcgcgcaccgaatcggccgcc
gcgagcctcgaggaaacggccgcgtcgatggaggagatcaccgcgacggtcggccagtcg
gcggccgcggccgggcaggccgacgagcgcgcggcggcggcgtcgcgaatcgcgtcgcac
ggcggcgcggtcgtgtcggaggtcgtcgcgacgatggcgaagatcgaggaagcgtcgggc
cggatcggcgacatcatcggcgtgatcgacggcattgcgttccagaccaacatcctcgcg
ctgaacgcggcggtcgaagccgcgcgcgcgggcgagcagggccgcggcttcgcggtggtc
gcgcaggaagtccgcagtctcgcgcagcgcagcgcgcaggccgcgcgcgaggtgaaggtg
ctggtcgaatcgacggtcgagagcgtgtcggcagggtcgggacaggtgcgtcaggccggc
gagacgatgcgcgagatcgtgtccaacgtgaccaacgtgacgacgatcatctccgagatc
acgcatgcggcgaacgagcagacgcgcggcatccaggaagtgaatcgcgcggtcacgcag
ctcgacgagatggtgcagcagaacgcggcgctcgtcgaacagtcgaccgcggcggcgtcc
gcgctgcagacgcaggcgaacgcgctcgcgtcgacggtcgggcagttcaaggtcgcgtga

DBGET integrated database retrieval system